KEGG   Mus caroli (Ryukyu mouse): 110304009
Entry
110304009         CDS       T05910                                 

Gene name
Igf1
Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04114  Oocyte meiosis
mcal04115  p53 signaling pathway
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04510  Focal adhesion
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04730  Long-term depression
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04913  Ovarian steroidogenesis
mcal04914  Progesterone-mediated oocyte maturation
mcal04935  Growth hormone synthesis, secretion and action
mcal04960  Aldosterone-regulated sodium reabsorption
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05205  Proteoglycans in cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05410  Hypertrophic cardiomyopathy
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110304009 (Igf1)
   04014 Ras signaling pathway
    110304009 (Igf1)
   04015 Rap1 signaling pathway
    110304009 (Igf1)
   04066 HIF-1 signaling pathway
    110304009 (Igf1)
   04068 FoxO signaling pathway
    110304009 (Igf1)
   04151 PI3K-Akt signaling pathway
    110304009 (Igf1)
   04152 AMPK signaling pathway
    110304009 (Igf1)
   04150 mTOR signaling pathway
    110304009 (Igf1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110304009 (Igf1)
   04115 p53 signaling pathway
    110304009 (Igf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110304009 (Igf1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110304009 (Igf1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    110304009 (Igf1)
   04914 Progesterone-mediated oocyte maturation
    110304009 (Igf1)
   04935 Growth hormone synthesis, secretion and action
    110304009 (Igf1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110304009 (Igf1)
  09156 Nervous system
   04730 Long-term depression
    110304009 (Igf1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110304009 (Igf1)
  09149 Aging
   04211 Longevity regulating pathway
    110304009 (Igf1)
   04213 Longevity regulating pathway - multiple species
    110304009 (Igf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110304009 (Igf1)
   05202 Transcriptional misregulation in cancer
    110304009 (Igf1)
   05205 Proteoglycans in cancer
    110304009 (Igf1)
  09162 Cancer: specific types
   05214 Glioma
    110304009 (Igf1)
   05218 Melanoma
    110304009 (Igf1)
   05215 Prostate cancer
    110304009 (Igf1)
   05224 Breast cancer
    110304009 (Igf1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110304009 (Igf1)
   05414 Dilated cardiomyopathy
    110304009 (Igf1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110304009 (Igf1)
   01522 Endocrine resistance
    110304009 (Igf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110304009 (Igf1)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110304009 (Igf1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 110304009
NCBI-ProteinID: XP_021030912
Ensembl: MGP_CAROLIEiJ_G0015701
UniProt: A0A6P5QQY3
LinkDB
Position
10
AA seq 184 aa
MNAFAEISVRVETIASPQSCVHLGLIVPTLTCCVNDPGPTKMTAPAIKIHIMSSSHLFYL
ALCLLTFTSSTTAGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDEC
CFRSCDLRRLEMYCAPLKPTKSARSIRAQRHTDMPKTQKSQSLSTNKKTKLQRRRKGSTF
EEHK
NT seq 555 nt   +upstreamnt  +downstreamnt
atgaatgcatttgcagagatatctgtacgggtagaaactattgcaagtcctcagtcttgt
gttcacctcggcctcatagtacccactctgacctgctgtgtaaacgacccgggacctacc
aaaatgaccgcacctgcaataaagatacacatcatgtcgtcttcacacctcttctacctg
gcgctctgcttgctcaccttcaccagctccaccacagctggaccagagaccctttgcggg
gctgagctggtggatgctcttcagttcgtgtgtggaccaaggggcttttacttcaacaag
cccacaggctatggctccagcattcggagggcacctcagacaggcattgtggatgagtgt
tgcttccggagctgtgatctgaggagactggagatgtactgtgccccactgaagcctaca
aaatcagcccgctctatccgtgcccagcgccacactgacatgcccaagactcagaagtcc
cagtccctatcgacaaacaagaaaacgaagctgcaaaggagaaggaaaggaagtacattt
gaagaacacaagtag

DBGET integrated database retrieval system