KEGG   Mus caroli (Ryukyu mouse): 110304228
Entry
110304228         CDS       T05910                                 

Gene name
Egfr
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04144  Endocytosis
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04520  Adherens junction
mcal04540  Gap junction
mcal04630  JAK-STAT signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal04912  GnRH signaling pathway
mcal04915  Estrogen signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal05160  Hepatitis C
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110304228 (Egfr)
   04012 ErbB signaling pathway
    110304228 (Egfr)
   04014 Ras signaling pathway
    110304228 (Egfr)
   04015 Rap1 signaling pathway
    110304228 (Egfr)
   04630 JAK-STAT signaling pathway
    110304228 (Egfr)
   04066 HIF-1 signaling pathway
    110304228 (Egfr)
   04068 FoxO signaling pathway
    110304228 (Egfr)
   04020 Calcium signaling pathway
    110304228 (Egfr)
   04072 Phospholipase D signaling pathway
    110304228 (Egfr)
   04151 PI3K-Akt signaling pathway
    110304228 (Egfr)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110304228 (Egfr)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110304228 (Egfr)
   04520 Adherens junction
    110304228 (Egfr)
   04540 Gap junction
    110304228 (Egfr)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110304228 (Egfr)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110304228 (Egfr)
   04915 Estrogen signaling pathway
    110304228 (Egfr)
   04921 Oxytocin signaling pathway
    110304228 (Egfr)
   04926 Relaxin signaling pathway
    110304228 (Egfr)
   04928 Parathyroid hormone synthesis, secretion and action
    110304228 (Egfr)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110304228 (Egfr)
   05206 MicroRNAs in cancer
    110304228 (Egfr)
   05205 Proteoglycans in cancer
    110304228 (Egfr)
   05230 Central carbon metabolism in cancer
    110304228 (Egfr)
   05231 Choline metabolism in cancer
    110304228 (Egfr)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110304228 (Egfr)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110304228 (Egfr)
   05212 Pancreatic cancer
    110304228 (Egfr)
   05225 Hepatocellular carcinoma
    110304228 (Egfr)
   05226 Gastric cancer
    110304228 (Egfr)
   05214 Glioma
    110304228 (Egfr)
   05218 Melanoma
    110304228 (Egfr)
   05219 Bladder cancer
    110304228 (Egfr)
   05215 Prostate cancer
    110304228 (Egfr)
   05213 Endometrial cancer
    110304228 (Egfr)
   05224 Breast cancer
    110304228 (Egfr)
   05223 Non-small cell lung cancer
    110304228 (Egfr)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110304228 (Egfr)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110304228 (Egfr)
   05171 Coronavirus disease - COVID-19
    110304228 (Egfr)
   05163 Human cytomegalovirus infection
    110304228 (Egfr)
   05165 Human papillomavirus infection
    110304228 (Egfr)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110304228 (Egfr)
   01522 Endocrine resistance
    110304228 (Egfr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110304228 (Egfr)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110304228 (Egfr)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110304228 (Egfr)
Protein kinases [BR:mcal01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   110304228 (Egfr)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   110304228 (Egfr)
  Exosomal proteins of pancreatic cancer cells
   110304228 (Egfr)
  Exosomal proteins of bladder cancer cells
   110304228 (Egfr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 110304228
NCBI-ProteinID: XP_021031116
Ensembl: MGP_CAROLIEiJ_G0016103
UniProt: A0A6P5QM34
LinkDB
Position
11
AA seq 1210 aa
MRPSGTARTTLLVLLTALCAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMYNNCEV
VLGNLEITYVQKNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNALYENTYALA
ILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNPILCNMDSIQWRDIVQNVFLSNMSMDL
QSHPSSCPKCDPSCPNGSCWGGGEENCQKLTKIICAQQCSHRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCQKFQDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGPDYYEVEEDGIRKCKKCDGPCRKVCNGIGIGEFKDTLSINATNIKHFK
YCTAISGDLHILPVAFKGDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPENWTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISDGDVIVSGNRNLCYANTINWKKL
FGTPNQKTKIMNNRAEKDCKAMNHVCNPLCSSEGCWGPEPRDCVSCQNVSRGRECVEKCN
ILEGEPREFVENSECIQCHPECLPQTMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGIM
GENNTLVWKYADANNVCHLCHANCTYGCAGPGLQGCEVWPSGPKIPSIATGIVGGLLFIV
VVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQAHLRILKETEFKKIKVL
GSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLL
GICLTSTVQLITQLMPYGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDL
AARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVW
SYGVTVWELMTFGSKPYDGIPASDISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSR
PKFRELILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLI
PQQGFFNSPSTSRTPLLSSLSATSNNSTVACINRNGSCRVKEDTFLQRYSSDPTGVVTED
NIDDAFLPVPEYINQSVPKRPAGSVQNPVYHNQPLHPAPGRDLHYQNPHSNAVGNPEYLN
TAQPTCLSSGFNSPALWIQKGSHQMSLDNPDYQQDFFPKETKPNGIFKGPTAENAEYLRV
APPSSEFIGA
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgcgaccctcagggaccgcgagaaccacactgctggtgctgctgaccgcgctctgcgcc
gcaggtggggcgctggaggaaaagaaagtctgccaaggcacaagtaacaggctcacccaa
ctgggcacttttgaagaccactttctgagcctgcagaggatgtacaacaactgtgaagtg
gtccttgggaacttggaaattacctatgtgcaaaagaattacgacctttccttcttaaag
accatccaggaggtggccggctatgtcctcattgccctcaacaccgtggagagaatccct
ttggagaacctgcagatcatcaggggaaatgctctttatgaaaacacctatgccttagcc
atcctgtccaactatgggacaaacagaactgggcttagggaactgcccatgcggaactta
caggaaatcctgattggtgctgtgcgattcagcaacaaccccatcctctgcaatatggac
tctatccagtggagggacatcgtccaaaacgtctttctgagcaacatgtcaatggactta
cagagccatccgagcagttgccccaaatgtgatccaagctgtcccaatggaagctgctgg
ggaggaggagaggagaactgccagaaattgaccaaaatcatctgtgcccagcaatgttcc
catcgttgtcgtggcaggtcccccagtgactgctgccacaaccaatgtgccgcggggtgt
acgggtccccgagagagtgactgtctggtctgccaaaagttccaagatgaggccacatgc
aaagacacctgcccaccactcatgctgtacaaccccaccacctatcagatggatgtcaac
cctgaagggaagtacagctttggtgccacgtgtgtgaagaagtgcccccgaaactatgtg
gtgacagatcatggctcatgtgtccgagcctgtgggcctgactactatgaagtggaagaa
gatggcatccgcaagtgtaaaaaatgtgatgggccctgtcgcaaagtttgtaatggcata
ggcattggtgaatttaaagacacactctccataaatgctacaaacatcaaacacttcaaa
tactgcactgccatcagcggggaccttcacattctgccagtggcctttaagggggattct
ttcacgcgcactcctcctctggacccacgagaactagaaattctaaaaaccgtaaaggaa
ataacaggctttttgctgattcaggcctggcctgaaaactggactgacctccatgctttc
gagaacctagaaataatacgtggcagaacaaagcaacatggtcagttttctttggcggtt
gttggcctgaacatcacatcactggggctgcgttccctcaaggagatcagtgatggggat
gtgatcgtttctggaaaccgaaatttgtgctacgcaaacacaataaactggaaaaaactc
ttcgggacacccaatcagaaaaccaaaatcatgaacaacagagctgagaaagactgcaag
gccatgaaccacgtctgcaatcctttatgctcctcagaaggctgctggggccctgagccc
agggactgtgtctcctgccagaatgtgagcagaggcagggagtgcgtggagaaatgcaac
atcctggagggggaaccaagggagtttgtggaaaattctgaatgcatccagtgtcatcca
gaatgtctaccccaaaccatgaacatcacctgtacaggcagggggccagacaactgcatc
cagtgtgcccactacattgatggcccacattgtgtcaagacctgcccagctggcatcatg
ggggagaacaacactctagtctggaagtatgcagatgccaataatgtctgccacctatgc
catgccaactgtacctatggatgtgctgggccaggccttcaaggatgtgaagtatggcca
tctgggccaaagataccatctattgccactgggattgtgggtggcctcctcttcatagtg
gtggtggcccttggaatcggcctattcatgcgaaggcgtcacattgttcgaaagcgtaca
ctacgccgcctgcttcaagagagagagctcgtggaacctctcacacccagcggagaagct
ccaaaccaagcccacttgaggatattaaaggaaacagaattcaaaaagatcaaagttctg
ggttcgggagcatttggcacagtgtataagggtctctggatcccagaaggcgagaaagta
aaaatcccagtggccatcaaggagttaagagaagccacatctccaaaagccaacaaagaa
atccttgacgaagcctatgtgatggctagtgtggacaaccctcatgtatgccgcctcctg
ggcatctgtctgacctccactgtccagctcattacacagctcatgccctacggttgcctc
ctggactatgtccgagaacacaaggacaacattggctcccagtacctcctcaactggtgt
gtgcagattgcaaagggcatgaactacctggaagatcggcgtttggtgcaccgtgacttg
gcagccaggaatgtactggtgaagacaccacagcatgtcaagatcacagattttgggctg
gccaaactgcttggtgctgaagagaaagaatatcatgcagaggggggcaaagtgcctatc
aagtggatggctttggaatcaattttacacagaatttatacacaccaaagcgatgtctgg
agctatggtgtcaccgtgtgggaactgatgacctttgggtccaagccttatgatggaata
ccagcaagtgacatctcatccatcctagagaaaggagaacgccttccacagccacctatc
tgcaccattgatgtctacatgatcatggtcaagtgctggatgatagatgctgacagccgc
ccaaagttccgagagttgattcttgaattctccaaaatggcccgagacccacaacgctac
cttgttatccagggggatgaaagaatgcacttgccaagccctacagactccaacttttac
cgagccctgatggatgaagaggacatggaggatgtagttgatgctgatgagtatcttatc
ccacagcaaggcttcttcaacagcccgtccacatccaggactcccctcttgagttctctg
agtgcaactagcaacaattccactgtggcttgcattaatagaaatgggagctgccgtgtc
aaagaagacaccttcttgcagcggtacagctccgaccccacaggtgttgtaacagaggac
aacatagatgatgcattcctccctgtacctgaatatataaaccaatctgttcccaagagg
ccagcaggctctgtgcagaaccctgtctatcacaatcagcccctgcatccagctcctgga
agagacctgcattatcaaaatccccacagcaatgccgtgggcaaccctgagtatctcaac
actgcccagcctacctgtctcagtagtgggtttaacagccctgcactctggatccagaaa
ggcagccaccaaatgagcctagacaaccctgactaccagcaggacttcttccccaaggaa
accaagccaaatggcatctttaagggccccacagctgaaaatgcagagtacctacgggtg
gcacctccaagcagtgagtttattggagcatga

DBGET integrated database retrieval system