KEGG   Mus caroli (Ryukyu mouse): 110304471
Entry
110304471         CDS       T05910                                 

Gene name
Flt4
Definition
(RefSeq) vascular endothelial growth factor receptor 3
  KO
K05097  FMS-like tyrosine kinase 4 [EC:2.7.10.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal05200  Pathways in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110304471 (Flt4)
   04014 Ras signaling pathway
    110304471 (Flt4)
   04015 Rap1 signaling pathway
    110304471 (Flt4)
   04020 Calcium signaling pathway
    110304471 (Flt4)
   04151 PI3K-Akt signaling pathway
    110304471 (Flt4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110304471 (Flt4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110304471 (Flt4)
  09162 Cancer: specific types
   05224 Breast cancer
    110304471 (Flt4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110304471 (Flt4)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110304471 (Flt4)
Protein kinases [BR:mcal01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   110304471 (Flt4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set Ig_2 ig VEGFR-2_TMD V-set
Other DBs
NCBI-GeneID: 110304471
NCBI-ProteinID: XP_021031563
Ensembl: MGP_CAROLIEiJ_G0016275
LinkDB
Position
11
AA seq 1246 aa
MQPGAALNLRLWLCLGLLQGLANGYSMTPPTLNITXDSYVIDTGDSLSISCRGQHPLEWT
WPGAQXVLTTGGKDSEDTRVVHDCEGTEARPYCKVLLLAQTHANNTGSYHCYYKYIKARI
EGTTAASTYVFVRDFKXXFINKPDTLLVNRKDSXWVPCLVSIPGLNITLRSQSSVLHPDG
QEVLWDDRRGMRVPTQLLRDALYLQCETTWGEKPFISVEWLKGPVLEATAGDELVKLPVK
LAAYPPPEFQWYKDRKAVTGRHNPHALVLKEVTEASAGVYTLALWNSAAGLRQNISLELV
VNVPPHIHEKEASSPSIYSRHSRQTLTCTAYGVPQPLSVQWHWRPWTPCKTFAQRSLRRR
QQRDGMPQCRDWKEVTTQDAVNPIESLDSWTEFVEGKNKTVSKLVIQDANVSAMYKCVVF
NKVGQDERLIYFYVTTIPDGFSIESEPSEDPLEGQSVRLSCRADNYTYEHLRWYRLNLST
LHDAQGNPLLLDCKNVHLFATPLEANLEEAEPGARHATLSLNIPRVAPEDEGDYVCEVQD
RRSQDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMRCPVAGAHVPSIVWYKDERL
LEKESGIDLADSNQRLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIV
ILIGTGVIAVFFWVLLLLIFCNMKRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQ
WEFPRERLHLGRVLGHGAFGKVVEASAFGINKGSSCDTVAVKMLKDGATASEHRALMSEL
KILIHIGNHLNVVNLLGACTKPNGPLMVIVEFCKYGNLSNFLRVKRDTFNPYAEKSPEQR
RRFRAMVEGAKADRRRPGSSDRALFTRFLMGKGSARRAPLVQEAEDLWLSPLTMEDLVCY
SFQVARGMEFLASRKCIHRDLAARNILLSESDIVKICDFGLARDIYKDPDYVRKGSARLP
LKWMAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLKDGTRMRAP
ELATPAIRHIMQSCWSGDPKARPAFSDLVEILGDLLQGGGWQEDEEERMALHSSQSSEED
GFMQASTTALHITEADADDSPPSMHCHSLAARYYNCVSFPGRLARGTKTPGSSRMKTFEE
LPMTPTTYKASMDNQTDSGMVLASEEFEELESRHRQEGSFSCKGPGQHMDIPRGHPDPQG
RRRRPAQGAQGGKVFYNNEYGEVSQPCTEGDCCPSAGSTFFADSSY
NT seq 3741 nt   +upstreamnt  +downstreamnt
atgcagcccggcgctgcgctgaacctgcgcctgtggctctgcctcggactcctccaaggc
ctggcaaatggttactccatgacccctccaaccctgaacatcacanaggattcatatgtg
attgacaccggggacagcctatccatatcctgcagggggcagcaccccctcgagtggacc
tggccaggggcccagnaggtactgaccacaggtgggaaggacagtgaagacacacgggtt
gtgcatgactgtgaaggcacagaagctaggccctactgcaaggtgctactgctggcccag
actcacgccaacaacacnggcagctaccactgctactacaagtacatcaaggcccggatt
gagggcaccacagctgccagcacctatgtgtttgtaagagactttaaacannctttcatc
aacaaacctgacacnctcctggtcaacaggaaggactcgatntgggtgccctgcttggtg
tccattcccggcctcaacatcacactgcgctcgcaaagctcagtgctgcaccccgacggg
caggaggtgctgtgggatgaccgccggggcatgcgagtgcccactcaactgttgcgcgat
gccctgtacctgcagtgcgagaccacctggggtgaaaagcccttcatcagtgtcgagtgg
ctcaaaggacctgtcctggaggccacagccggtgacgagctggtgaagctccccgtgaag
ctggcagcttatcccccaccggagttccaatggtacaaggacagaaaggcagtgactgga
cgccacaatccacatgctctggtactcaaagaggtgaccgaggccagcgcaggggtctac
actctcgccctgtggaactctgcagctggtctgaggcaaaacatcagtctggagctggtg
gtgaatgtgcctcctcacatccacgaaaaggaagcctcctcacccagcatctactcccgc
cacagtcgacagaccctcacctgcaccgcctatggagtaccccaacccctcagtgtccag
tggcactggaggccctggacaccctgcaagacctttgcccagcgcagcctccggaggcgg
cagcagcgggatggcatgccacagtgccgagactggaaggaggtgaccactcaggacgct
gtgaaccccattgagagcctggacagctggaccgagtttgtggaggggaagaataagacg
gtgagcaagctggtgatccaggacgccaatgtgtcagccatgtacaagtgtgtggtcttc
aacaaagtgggccaggatgagcgactcatctacttctatgtgaccaccatcccggacggt
ttcagtatcgaatcggagccttctgaggatcccttagaaggccagtccgtgcgccttagc
tgccgggcggacaactacacgtacgaacatctgcgctggtaccggctcaacctctccaca
ctgcacgatgctcaagggaaccccctattgctggactgcaagaacgtgcacctgtttgcc
acgcccctagaggccaacctagaggaggcagagcccggggcccgccacgccaccctcagt
ttgaatatcccccgagtggcgcccgaggacgagggtgactacgtgtgtgaggtgcaggat
aggcgcagccaggacaagcactgccacaagaagtacctgtccgtgcaggccctggaagct
cctcggctcacgcagaacttgaccgacctcctggtgaacgtgagtgactccctggagatg
cgatgcccggtggccggagcgcatgtgcccagtattgtgtggtacaaagatgaaaggctc
ctggagaaagagtcaggaatcgacctggcagactccaatcagaggctgagcatccagcgc
gtgcgcgaggaggacgcaggtcgttatctgtgcagcgtgtgcaatgccaagggctgcgta
aactcctctgccagcgtggcagtggaaggctctgaagataaaggcagcatggagattgtg
atactcattggcactggcgtcatcgcagttttcttctgggtcctcctcctgctcatcttc
tgtaacatgaaaaggcctgcccatgcagacatcaagacgggctacctgtccatcatcatg
gaccccggggaggtgcctttggaggagcagtgtgaatacctgtcctatgacgccagccag
tgggagttccccagggaaaggttgcacctcgggagagtcctaggccacggggcttttggg
aaggtggtggaagcctcagcttttggcatcaataaaggcagcagctgtgacaccgtggcc
gtgaagatgctgaaagatggcgctactgccagcgagcaccgtgccctgatgtccgagctc
aagatcctaattcacatcggcaaccatctcaacgtggtcaacctcctaggggcgtgcacc
aagcccaacggccctctcatggtgatcgtggagttttgcaaatacggcaacctctccaac
tttttgcgtgtcaagcgggacacgttcaacccctatgcggagaagtctccggagcaacgc
aggcgcttccgcgccatggtagaaggcgccaaagctgataggaggagacctggaagcagc
gacagagccctgttcacgcggttcctgatgggcaagggaagtgcacggcgagccccactt
gtccaagaagctgaggacctatggctgagcccactgaccatggaagaccttgtatgctac
agcttccaagttgcccggggaatggagttcctggcttcccgcaagtgcattcacagagac
ctggctgctcggaacatcctactgtcagaaagtgacatagtgaagatctgcgactttggc
ctcgctcgggacatctacaaagaccctgactatgtccgaaagggcagtgcccgactgcct
ctgaaatggatggcccccgagagcatctttgataaggtgtacaccacgcagagtgatgtg
tggtccttcggtgtgctgctgtgggagatcttctcattgggggcctctccataccctggg
gttcagatcaatgaggagttctgccagcggctgaaggatggcactcgaatgagggccccg
gaactcgccactcctgccatacgccacatcatgcagagttgctggtctggagaccctaaa
gcaagacctgctttctctgacctagtggagatcctgggggacctgcttcagggcggaggc
tggcaggaggacgaagaggaacgcatggccctgcacagctctcagagctccgaggaggat
ggcttcatgcaggcatccaccacagctctacatatcaccgaagcggacgctgatgatagt
ccacccagcatgcattgccacagcctggcagccagatattacaactgtgtgtcctttcct
gggcgcctggccagaggcactaagactccaggctcctccaggatgaagacatttgaagaa
ttgcccatgacccctacaacctacaaagcctccatggataaccagacagacagcggaatg
gtgctggcctcagaagagtttgaggagctagaaagcaggcatagacaagaaggcagcttc
agctgtaaaggtcctggccagcacatggatattcccagaggacaccctgacccccagggg
aggcgccgacggcccgctcaaggggcacaaggaggcaaggtgttttataacaacgagtat
ggggaggtctcccagccatgtacagaaggtgactgctgcccgtctgctggctccaccttc
ttcgcagacagcagctactaa

DBGET integrated database retrieval system