KEGG   Mus caroli (Ryukyu mouse): 110304475
Entry
110304475         CDS       T05910                                 

Definition
(RefSeq) interferon-inducible protein AIM2
  KO
K12966  absent in melanoma 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04621  NOD-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110304475
   04623 Cytosolic DNA-sensing pathway
    110304475
SSDB
Motif
Pfam: HIN PYRIN ProQ_C
Other DBs
NCBI-GeneID: 110304475
NCBI-ProteinID: XP_021031567
Ensembl: MGP_CAROLIEiJ_G0014915
UniProt: A0A6P7QS13
LinkDB
Position
1
AA seq 354 aa
MESEYREMLLLTGLDHITEEELKRFKYFALTEFQIARSTLDVADRTELADHLIQSAGAAS
AVTKAINIFQKLNYMHIANALEEKKKEAERKFMTNTKKRGTQKVENRSQAENCSAASATH
SDNDFKEQAATEVCPQAKPQKKQMVAEQEAIREDLQKDPLVVTVLKAINPFECETQEGRQ
EIFHATVATETDFFFVKVLNAQFKDKFIPKRTIKISNYLWHNNFMEVTSSSVVVDVESNH
VVPNNVVKRAKETPRISKLKIQPCGTIVNGLFKVQKITEEKDRVLYVIHDKTGTMEVLVL
ENPSKTKCEEGDKIRLTFFEVSKNGVKIQLKSGPCSFFKVIKAAKPKTDMKSVE
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggagagtgaatacagggaaatgctgttgttgaccggcctggaccacatcacggaggag
gaactgaaacggttcaagtactttgctttgactgagtttcagattgccaggagcacactc
gacgttgcagataggacagagttagctgaccacctgattcaaagtgcaggtgcagcatct
gcagtgaccaaggccattaatattttccagaagttgaattatatgcatattgcaaatgct
cttgaagagaaaaagaaagaagctgaacgtaaattcatgaccaatacaaagaagagagga
acacagaaggtagaaaatagaagtcaagctgaaaactgctctgctgcctctgccacccac
agtgacaatgactttaaggagcaggctgctacagaagtctgtcctcaagctaagcctcag
aagaaacagatggtggcagaacaggaagccatcagagaagatttacagaaagatccactt
gtagtcacagtgctgaaagctataaatccctttgagtgtgagactcaggaaggaagacaa
gagatatttcatgcaacagtggccacggagacagattttttctttgtaaaagttttaaat
gcacagtttaaagataaatttatcccaaagagaacaattaaaatatcaaactacctttgg
cacaataacttcatggaggtcaccagttcctcagttgtggttgatgttgaatctaaccat
gtagtcccaaataacgttgttaagagagccaaggaaactcccaggattagtaaactgaag
attcagccgtgtggaacaattgtgaatgggctgtttaaagtccagaagataacagaggaa
aaagatagagtactatatgttatacatgataaaacagggacaatggaggtgttggtgctg
gaaaacccaagcaaaacaaagtgcgaggaaggagacaagattagactcacattctttgag
gtgtcaaaaaatggagtgaaaattcagttgaaatctggaccttgtagcttttttaaggtt
attaaggctgcaaagccaaaaactgacatgaaaagtgtggagtga

DBGET integrated database retrieval system