KEGG   Mus caroli (Ryukyu mouse): 110304614
Entry
110304614         CDS       T05910                                 

Gene name
Brca1
Definition
(RefSeq) breast cancer type 1 susceptibility protein isoform X1
  KO
K10605  breast cancer type 1 susceptibility protein [EC:2.3.2.27]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal03440  Homologous recombination
mcal03460  Fanconi anemia pathway
mcal04120  Ubiquitin mediated proteolysis
mcal04151  PI3K-Akt signaling pathway
mcal05206  MicroRNAs in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110304614 (Brca1)
  09124 Replication and repair
   03440 Homologous recombination
    110304614 (Brca1)
   03460 Fanconi anemia pathway
    110304614 (Brca1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110304614 (Brca1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    110304614 (Brca1)
  09162 Cancer: specific types
   05224 Breast cancer
    110304614 (Brca1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110304614 (Brca1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110304614 (Brca1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcal04121]
    110304614 (Brca1)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110304614 (Brca1)
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110304614 (Brca1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     110304614 (Brca1)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110304614 (Brca1)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    110304614 (Brca1)
  Multi subunit Ring-finger type E3
   BRCC complex
    110304614 (Brca1)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     110304614 (Brca1)
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     110304614 (Brca1)
    BRCA1-A complex
     110304614 (Brca1)
    BRCA1-B complex
     110304614 (Brca1)
    BRCA1-C complex
     110304614 (Brca1)
    BRCA complex
     110304614 (Brca1)
   FA (Fanconi anemia) pathway
    Downstream FA components
     110304614 (Brca1)
SSDB
Motif
Pfam: BRCT_assoc BRCT zf-C3HC4 zf-C3HC4_2 BRCT_2 zf-C3HC4_4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-RING_5 zf-Nse zf-RING_6 zf-ANAPC11 Prok-RING_4 zf-RING_10 zf-rbx1
Other DBs
NCBI-GeneID: 110304614
NCBI-ProteinID: XP_021031691
Ensembl: MGP_CAROLIEiJ_G0017223
UniProt: A0A6P5QLK8
LinkDB
Position
11
AA seq 1809 aa
MDLSAARIQEVQSVLHAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ
CPLCKNEITKRSLQGSTRFSQLVEELLKIMAAFELDTGMQVTNGFSFSKKKNNSCERLNE
EESIIQSVGYRNRVRRLPQVEPGNATLKDSLSVQVSNLGIVRSVKKNRQTQPRKKSVYIE
LDSDSSEETVTKPGDCSVRDRELLQTAPQEAGDEGKVRSAGEAACEFSEGIRNIEHHQCS
DDLNPTENHATERHPEKCQSISVSNVRVEPCGTDAHASSLQPETSSLLLIEDRMNAEKAE
FCNKSKQPGIAVSQQSRWAASKETCNDRQVPSTGEKVGPNADSLSDRKKWTHPQSLCPEN
SGPATDVSWITLNSSIQKVNEWFSRTGEMLTSDSASAGRHESNAEAAVVLEVSNEVDGGF
SSSRKTDLAAPDPHHTLMCKSGRDFSKPVENNINDKIFGKSYQRKGSRPHLNHVTEIIGT
FITEPQITQEQPFTNKLKRKRRTSLQPEDFIKKADSAGVQRTPDNTNQGAGPMEPHEQAV
STTSNCQENTIEGSNLQKERNACPTESLRKEPASTAGAKSKSNSVSDLEVELNVRSSKAP
KKNRLRKKSSTRCVLPLEPISRNPSPPTCAELEIDSCGSTEETKKNSSNQQPARHLREPQ
LIEDTEPAADAKKNEPNEHIRKRRASDAFPEEKLMNKAGLLTSCSSPRKSQGPVNPNPQK
TGTEQVETRQIPDSAKELRDQVLRGEPSGKTTDRSEESTSVSLVPDTDYDTQNSVSVLEA
NTVRYARTGSAQCMTQFVASENPKELVHGSNNAGSGTECLKPPLRHELNHSQEKVEMEDS
ELDTQYLQNTFQVSKRQSFALFSKPRSPQKDCASPKVTAKGKQKERQGQEEFEISHVQAV
AATVGLPVPCQEGKLAADTMCDRGSRLCPSSHYRSGENGLSATGKSGISQNSHFKQSVSP
TRSSIKIDNRKPLTEGRFEKHTSSTEKAVGNENILQSTVHTISLNNRGNACQEASSGSIH
EVCSTGDSFPGQLGRNRGPKVNTVLLLDSTQPGVCQQSVPVSDKYLEIKKQEGEAVCADF
SPCLFSDHLEQSMRSGKVFQVCSETPDDLLDDVEIQGHTSFGEGDVMERSAVFNGSILRR
ESSRSPSPVTHASKSRSLPRASRKLESSEESDSTEDEDLPCFQHLLSRISNTPELNRCSS
AVTQPMPEKAEGTQAPWKGSISDCNNEVIVIEASQEHQLSEDPRCSGSMFSSQHSAAQGS
TAIANSQDPNFNPPSKPRSHQSGNEEAFLSDKELISDNEEMATCLEEDNDQEEDSIVPDS
EASGYESETNLSEDCSQGDILTTQQRATMKYNLIKLQQEMAHLEAVLEQRGNQPSGHSPS
LLADPCALEDLPDLEPNMSGAAVLTSKNINENPVSQNLKSACDDKFQPQHREGPTGGDDE
SGMGRPSPFQSLLAGSRGSAHGRSRCLQKRRSPSQEELLQPAGSETSSEPHNSTGRSCLP
RQDLEGTPYLESGISLFSSRDPESESPKEPAHIGTTPASTSALKISQGQVAESFRSAAAA
GADKAVAGIVSKIKPELTSSEERADRDIAMVVSGLTPNEVMIVRKFAEKYRLTLTDAITE
ETTHVIIKTDAEFVCERTLKYFLGIAGGKWIVSYSWVVRSIQERKLLNVHEFEVKGDVVT
GRNHQGPRRSRESREKLFKGLQVYCCEPFTNMPKDELERMLQLCGASVVKELPSLTHDTG
AHAVVIVQPSAWTEDSNCPDIGQLCKARLVMWDWVLDSLSSYRCRDLDAYLVQNITCVPD
SSEPQDSND
NT seq 5430 nt   +upstreamnt  +downstreamnt
atggatttatctgccgctcgaattcaagaagtacaaagtgtccttcatgctatgcagaaa
atcttagagtgtccaatctgtttggaactgatcaaagaacctgtttccacaaaatgtgac
cacatattttgcaaattttgtatgctgaaacttcttaaccagaagaaagggccttcacaa
tgtcctttgtgtaagaatgagataaccaaaaggagcctacaaggaagcacaaggtttagt
cagcttgttgaagagctgctgaaaatcatggctgcttttgagcttgacacgggaatgcag
gttacaaatggttttagtttttcaaaaaagaaaaataattcttgtgagcgtttgaatgag
gaggagtctatcatccagagcgtgggctaccggaaccgtgtcagaagacttccccaggtc
gaacctggaaatgccaccttgaaggacagcctcagtgtccaggtgtctaaccttggcatc
gtgagatcagtgaagaaaaacaggcagacccaacctcgaaagaaatctgtctacattgaa
ctagactctgactcttctgaagagacagtaactaagccaggtgattgcagtgtgagagac
cgggaattgttacagaccgcccctcaagaagccggagatgaaggcaaggtgcgctctgca
ggagaggctgcttgtgagttttctgagggcataagaaacattgaacatcatcaatgcagt
gatgatttgaaccctactgagaatcatgcaactgaaaggcatccagaaaaatgtcagagt
atttctgtttcaaacgtgcgtgtggagccatgtggcacagatgctcatgccagctcatta
cagcctgagaccagcagtttattgctcattgaagacagaatgaatgcagaaaaggctgaa
ttctgtaataaaagcaaacagcctggcatagcagtgagccagcagagcagatgggcggca
agtaaagaaacatgtaacgacaggcaggttcccagcactggggaaaaggtgggtccaaat
gctgactccctcagtgatagaaagaagtggactcacccgcaaagtctgtgccctgagaat
tctggacctgccaccgatgtttcttggataacactaaatagcagcattcagaaagttaat
gagtggttttccagaactggtgaaatgttaacttctgacagcgcatctgctgggaggcac
gagtcaaatgctgaagcagctgttgtgttggaagtttcaaatgaagtggatgggggtttc
agttcttcaaggaaaacagacttagcagcccccgacccccatcatactttaatgtgtaaa
agtggaagagacttctccaaaccagtagagaataatatcaatgataaaatatttgggaaa
tcctatcagagaaagggaagccgccctcacctgaaccatgtgactgaaattataggcaca
tttattacagagccacagataacacaagagcagcccttcacaaataaattaaaacgtaaa
agacgtacatcccttcagcctgaggacttcatcaagaaagcagattcagcaggtgttcag
aggactcccgacaacacaaatcagggagctggcccaatggagccacatgagcaagcagtg
agtactaccagtaactgtcaggagaacacaatagaaggtagtaatctccagaaagagaga
aacgcctgtccaacggaatcattgagaaaggagcctgcttccacagcaggagccaaatct
aaaagcaacagtgtaagtgatttggaggtagaattaaatgtccgcagttcaaaagcacct
aagaaaaataggctgaggaagaagtcttctaccaggtgtgttcttccacttgaaccaatc
agtagaaatccaagcccacctacttgtgctgaacttgagatcgatagttgtggtagcact
gaagaaacaaagaaaaacagttccaaccaacagccagccaggcaccttagagagcctcaa
ctcatcgaagacactgaacctgcagcggatgccaagaagaacgagccaaatgaacacata
aggaagagacgtgccagcgatgctttcccagaagagaaattaatgaacaaagctggttta
ttaactagctgttcaagtcctcgaaaatctcaagggcctgtcaatcccaaccctcagaaa
acaggaacagagcaagttgaaacacgccaaatacctgacagtgccaaagaactcagggat
caggtcctgagaggagagcccagtggcaaaaccactgaccgatctgaggagagcaccagc
gtgtccttggtacctgacactgactacgacactcagaacagtgtctccgtcctggaagct
aacactgtcagatatgcaagaacaggatccgctcagtgtatgactcagtttgtagcaagc
gagaaccccaaagaactcgtccatggctctaacaatgctgggagtggcacagagtgtctc
aagccccccttgagacacgagcttaaccacagtcaggagaaagtagaaatggaagacagt
gaacttgatactcagtatttgcagaatacatttcaagtttcaaagcgtcagtcatttgct
ttattttcaaaacctagaagtccccaaaaggactgtgcgagtccaaaggtgacagctaaa
ggtaaacaaaaagaacgtcagggacaggaagagtttgaaatcagtcacgtacaggcagtt
gcagccacggtgggcttacctgtgccctgtcaggaaggtaagctagctgctgatacaatg
tgtgatagaggttctaggctttgcccatcatctcattacagaagcggggagaatggactc
agcgccacaggtaaatcgggaatttcacaaaactcacattttaaacaatcagtttctccc
accaggtcatctataaaaattgacaatagaaaacctctgacagagggacgatttgagaaa
catacatcatcaactgaaaaggcggtgggaaatgagaacattcttcagagtacagtgcac
acaattagcctgaataacagaggaaatgcttgtcaagaagccagctcaggcagtattcat
gaagtatgttccactggtgactccttcccgggacagctaggtagaaacagagggcctaag
gtaaacaccgtgcttctattagatagtacgcagcctggtgtctgtcagcaaagtgttcct
gtaagtgataagtatcttgaaataaaaaagcaggagggtgaggctgtctgtgcagacttt
tctccgtgtctattctcagaccatcttgagcaatctatgagaagtggtaaggtttttcag
gtttgctctgagacacctgatgacctgctagatgatgttgaaatacagggacatactagc
tttggtgaaggtgacgtaatggagagatctgctgtctttaacggaagcatcctaagaaga
gagtccagtaggagccctagtcctgtaacccatgcatcgaagtctcggagtctccccaga
gcatctaggaaactagaatcctcagaagagagcgactccactgaggatgaagatctcccc
tgcttccaacacttactgagcagaataagcaacacacctgaactgaacagatgcagcagt
gctgtgacacagcctatgccggagaaagcggaggggacccaagcaccatggaagggtagc
atcagtgactgcaataatgaggtgattgtgatagaggcatctcaggagcatcagctgagt
gaggatccaagatgctctggcagcatgttctcttcacagcacagtgctgcccaagggtca
actgcaattgcaaactcccaggatcccaattttaatccaccttccaaaccgaggagtcac
cagtctgggaatgaggaagctttcctaagtgacaaggaattgatttcagataacgaggaa
atggcaacttgcctagaagaggataatgaccaagaagaggatagtatagtcccagactca
gaggcgtccggatacgagagtgaaacaaacctttctgaagactgctcgcagggagatatt
ttaaccactcagcagcgagcgaccatgaagtataacctgataaagctgcagcaggaaatg
gctcacctggaagctgtgctggagcagcgtgggaaccagccttctggccactccccttcc
ctcctagcagacccttgtgccctggaagacctgccagatctggaaccaaacatgtcagga
gcagcagttttaacttcaaagaacattaatgagaatcctgtaagccaaaatctgaagagc
gcttgtgatgacaaattccaaccacaacatcgggagggtcccaccggtggagatgacgag
tcagggatgggaaggccttccccttttcaatctctgttggcaggcagtaggggttctgca
catggccgctctaggtgtcttcaaaagagaaggtccccctctcaggaggagctcctccag
cctgctggatcagagacatcatctgagccacacaattccacagggcggtcttgcctgcca
aggcaagatctagaaggaaccccatacctggaatctggaatcagccttttctctagtaga
gaccccgagtctgagtcccctaaagagccagcccacattggcaccacaccagcttcaacc
tctgcactgaaaatatcccaaggtcaagttgctgagtctttcaggagtgcagctgctgct
ggtgctgataaagcagtggcaggaattgtgagcaagataaagccggaattgacatcttca
gaagaaagagcggatagagacatagccatggtggtgtcaggcttgacccccaacgaagta
atgattgtgcgaaagtttgctgaaaaataccgcctcacgttaactgacgctatcactgag
gagactacacatgtaattataaaaacagatgctgagtttgtgtgtgagcggacactgaaa
tattttctgggcattgcaggaggaaagtggatagttagctattcgtgggtggtccggtct
atccaagaaagaaaacttctgaatgtgcatgaatttgaagtcaaaggagatgttgtgact
ggaagaaatcaccaaggtccaaggcgatccagagaatcccgggaaaagctcttcaagggc
ctacaggtctattgttgtgagcccttcaccaacatgcccaaagatgagctggagaggatg
ctgcagctgtgtggggcttccgtggtgaaggagcttccatcgctcacccatgacacaggt
gctcatgcagttgtgatcgtgcagccaagcgcctggacagaagacagcaactgcccggat
attgggcagctgtgcaaggcacgtctagtgatgtgggactgggtgttggacagtctatcc
agctaccggtgtcgggatctggatgcctacctggtacagaatatcacctgtgtccctgac
agtagtgagccacaagactccaatgattaa

DBGET integrated database retrieval system