KEGG   Mus caroli (Ryukyu mouse): 110304621
Entry
110304621         CDS       T05910                                 

Gene name
Nos2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00220  Arginine biosynthesis
mcal00330  Arginine and proline metabolism
mcal01100  Metabolic pathways
mcal04020  Calcium signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04146  Peroxisome
mcal04371  Apelin signaling pathway
mcal04926  Relaxin signaling pathway
mcal05010  Alzheimer disease
mcal05014  Amyotrophic lateral sclerosis
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05133  Pertussis
mcal05140  Leishmaniasis
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05146  Amoebiasis
mcal05152  Tuberculosis
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    110304621 (Nos2)
   00330 Arginine and proline metabolism
    110304621 (Nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110304621 (Nos2)
   04066 HIF-1 signaling pathway
    110304621 (Nos2)
   04020 Calcium signaling pathway
    110304621 (Nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110304621 (Nos2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110304621 (Nos2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110304621 (Nos2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110304621 (Nos2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110304621 (Nos2)
   05014 Amyotrophic lateral sclerosis
    110304621 (Nos2)
   05022 Pathways of neurodegeneration - multiple diseases
    110304621 (Nos2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110304621 (Nos2)
   05152 Tuberculosis
    110304621 (Nos2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110304621 (Nos2)
   05145 Toxoplasmosis
    110304621 (Nos2)
   05140 Leishmaniasis
    110304621 (Nos2)
   05142 Chagas disease
    110304621 (Nos2)
Enzymes [BR:mcal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     110304621 (Nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 110304621
NCBI-ProteinID: XP_021031701
Ensembl: MGP_CAROLIEiJ_G0016818
LinkDB
Position
11
AA seq 1145 aa
MACPWKFLFKVKSYQGDLKEEKDINNNVKKIPGAVLSPTIQDDPKSHQNGSPQLLTGTAQ
NVPESLDKLHVTPSTRPQYVRIKNWGSGEILHDTLHHKATSDFTCKSKSCLGSIMNPKSL
TRGPRDKPIPLEELLPQAIEFINQYYGSFKEAKIEEHLARLEAVTKEIETTGTYQLTLDE
LIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQYICRHILYATNNGNIRSAIT
VFPQRSDSKHDFRLWNSQLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDVL
PLVLQADGQDPEVFEIPPDLVLEVTMEHPKYEWFQELGLKWYALPAVANMLLEVGGLEFP
ACPFNGWYMGTEIGVRDFCDTQRYNILEEVGRRMGLETHTLASLWKDRAVTEINIAVLHS
FQKQNVTIMDHHTASESFMKHMQNEYRARGGCPADWIWLVPPVSGSITSVFHQEMLNYVL
SPFYYYQIEPWKTHIWQNEKLRPRRREIRFRVLVKAVFFASVLMRKVMASRVRATVLFAT
ETGKSEALARDLATLFSYAFNTKVVCMDQYKASALEEEQLLLVVTSTFGNGDCPSNGQTL
KKSLFMLRELNHTFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLAPTGEGDELSGQ
EDAFRSWAVQTFRAACETFDVRSKHHIQIPKRYTSNATWEPQQYRLIQSPEPLDLNRALS
SIHAKNVFTMRLKSQQNLQSEKSSRTTLLVQLTFEGSRGPSYLPGEHLGIFPGNQTALVQ
GILERVVDCPTPHQTVCLEVLDESGSYWVKDKRLPPCSLSQALTYFLDITTPPTQLQLHK
LARFAMDEADRQRLEALCQPSEYNDWKFSNNPTFLEVLEEFPSLRVPAAFLLSQLPILKP
RYYSISSSQDHTPSEVHLTVAVVTYRTRDGQGPLHHGVCSTWISNLKPQDPVPCFVRSVS
GFQLPEDPSQPCILIGPGTGIAPFRSFWQQRLHDSQHKGLKGGRMTLVFGCRHPEEDHLY
QEEMQEMVRKRVLFQVHTGYSRLPGKPKVYVQDILQKQLANEVLSVLHGEQGHLYVCGDV
RMARDVATTLKKLVATKLNLSEEQVEDYFFQLKSQKRYHEDIFGAVFSYGAKKGSALEEP
KATRL
NT seq 3438 nt   +upstreamnt  +downstreamnt
atggcttgcccctggaagtttctcttcaaagtcaaatcctaccaaggtgacctgaaagag
gaaaaggacattaacaacaacgtgaagaaaatcccaggtgctgttctcagcccaacaata
caggatgaccctaagagtcaccaaaatggctccccccagctcctcaccgggacagcacag
aatgttccagaatccctggacaagctgcacgtgactccatcgacccgtccacaatatgtg
aggatcaaaaactggggcagtggagagattttgcatgacactcttcaccacaaggccaca
tcggatttcacttgcaagtccaaatcttgcttggggtccatcatgaaccccaagagtttg
accagaggacccagagacaagcctatccctctggaggagctcctgcctcaagccattgag
ttcatcaaccagtattatggctcctttaaagaggcaaaaatagaggaacatctggccagg
ctggaagctgtaacaaaggaaatagaaacaacaggaacctaccaactcactctggatgag
ctcatctttgccaccaagatggcctggaggaatgcccctcgctgcatcggcaggatccag
tggtccaacttgcaggtctttgacgctcggaactgtagcacagcacaggaaatgtttcag
tacatctgcagacacatactttacgccaccaacaacggcaacatcaggtcggccatcact
gtgttcccccagcggagtgacagcaaacatgacttcaggctctggaattcacagctcatc
cggtacgctggctaccagatgcccgatggcaccatcagaggggatgctgccaccttggag
ttcactcagttgtgcatcgacctaggctggaagccccgctatggccgcttcgatgtgctg
cctctggtcctgcaggctgacggtcaagatccagaggtctttgaaatccctcctgatctt
gtgttggaggtgaccatggagcatcccaagtacgagtggttccaggagctcgggctgaag
tggtatgcactgcctgccgtggccaatatgctactggaggtgggtggcctcgaattccca
gcctgccccttcaatggttggtacatgggcaccgagattggagttcgagacttctgtgac
acacagcgctacaacatcctggaggaagtgggcagaaggatgggcctggagacccacaca
ctggcctccctctggaaagaccgggctgtcacggagatcaatatcgctgtgctccatagt
ttccagaagcaaaatgtgaccatcatggaccaccacacagcctcagagtccttcatgaag
cacatgcagaatgagtaccgggctcgaggaggctgcccggcagactggatttggctggtc
cctccggtgtcggggagcatcacctctgtgttccaccaggagatgttgaactatgtccta
tctccattctactactaccagatcgagccctggaagacccacatctggcagaatgagaag
ctgaggcccaggaggagagagatccgatttagagtcttggtgaaagcggtgttctttgct
tccgtgctaatgcgaaaggtcatggcttcccgggtcagagccacagtcctctttgccact
gagacggggaagtctgaagcactagccagggacctggccaccttgttcagctacgccttc
aacaccaaggttgtctgcatggaccagtataaggcaagcgccttggaagaggagcaacta
ctgctggtggtgacaagcacgtttgggaatggagattgtcccagcaatggacagactctg
aagaaatctctgttcatgctgagagaactcaaccacaccttcaggtatgctgtgtttggc
cttggctccagcatgtaccctcagttctgcgcctttgctcatgacatcgaccagaagctg
tcccacctgggagcctctcagcttgccccaacaggagaaggggacgaactcagtgggcag
gaggatgccttccgcagctgggctgtacaaaccttccgggcagcctgtgagacctttgat
gttcgaagcaaacatcacattcagatcccgaaacgctacacttccaatgcaacatgggag
ccacagcaatataggctcatccagagcccggagcctttagacctcaacagagccctcagc
agcatccatgccaagaacgtgttcaccatgaggctgaaatcccagcagaatctgcagagt
gagaagtccagccgcaccaccctcctcgttcagctcaccttcgagggcagccgagggccc
agctacctgcctggggaacacctggggatctttccaggcaaccagaccgccctggtgcag
ggaatcttggagcgagttgtggattgtcctacaccacaccaaactgtgtgcctggaggtt
ctggatgagagcggcagctactgggtcaaagacaagaggctgcccccttgctcactcagc
caagccctcacctacttcctggacatcacgacccctcccacccagctgcagctccacaag
ctggctcgctttgccatggacgaggcggataggcagagattggaggccttgtgtcagccc
tcagagtacaatgactggaagttcagcaacaaccccacgttcctggaggtgcttgaagag
ttcccttccttgcgcgtgcccgctgccttcctgctgtcgcagctccctatcttgaagccc
cgctactactccatcagctcctcccaggaccacaccccctcggaggttcacctcactgtg
gctgtggtcacctaccgcacccgagatggtcagggtcccctgcaccatggtgtctgcagc
acttggatcagtaacctgaagccccaggacccagtgccctgctttgtgcgaagtgtcagt
ggcttccagctccctgaggacccctcccagccttgcatccttattgggcctggtacgggc
attgctcccttccgaagtttctggcagcagcggctccatgactcccagcacaaagggctc
aaaggaggccgcatgaccttggtgtttgggtgccggcacccagaggaggaccacctctat
caggaagaaatgcaggagatggtccgcaagagagtgctgttccaggtgcacacaggctac
tcccggctgcccggcaaacccaaggtctacgttcaggacatcctgcagaagcagctcgcc
aacgaggtactcagcgtgctccacggggagcagggccacctctacgtttgcggagatgtg
cgcatggctcgggatgtggctaccacgttgaagaagctggtggccaccaagctgaacttg
agcgaggagcaggtggaagactatttcttccagctcaagagccagaaacgttatcatgaa
gatatcttcggtgcagtcttttcctatggggcaaaaaagggcagcgccttggaggagccc
aaagccacgaggctctga

DBGET integrated database retrieval system