KEGG   Mus caroli (Ryukyu mouse): 110304772
Entry
110304772         CDS       T05910                                 

Gene name
Grb2
Definition
(RefSeq) growth factor receptor-bound protein 2
  KO
K04364  growth factor receptor-bound protein 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04062  Chemokine signaling pathway
mcal04068  FoxO signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04380  Osteoclast differentiation
mcal04510  Focal adhesion
mcal04540  Gap junction
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04714  Thermogenesis
mcal04722  Neurotrophin signaling pathway
mcal04910  Insulin signaling pathway
mcal04912  GnRH signaling pathway
mcal04915  Estrogen signaling pathway
mcal04917  Prolactin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04935  Growth hormone synthesis, secretion and action
mcal05034  Alcoholism
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110304772 (Grb2)
   04012 ErbB signaling pathway
    110304772 (Grb2)
   04014 Ras signaling pathway
    110304772 (Grb2)
   04630 JAK-STAT signaling pathway
    110304772 (Grb2)
   04068 FoxO signaling pathway
    110304772 (Grb2)
   04072 Phospholipase D signaling pathway
    110304772 (Grb2)
   04151 PI3K-Akt signaling pathway
    110304772 (Grb2)
   04150 mTOR signaling pathway
    110304772 (Grb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110304772 (Grb2)
   04540 Gap junction
    110304772 (Grb2)
   04550 Signaling pathways regulating pluripotency of stem cells
    110304772 (Grb2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110304772 (Grb2)
   04660 T cell receptor signaling pathway
    110304772 (Grb2)
   04662 B cell receptor signaling pathway
    110304772 (Grb2)
   04664 Fc epsilon RI signaling pathway
    110304772 (Grb2)
   04062 Chemokine signaling pathway
    110304772 (Grb2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110304772 (Grb2)
   04912 GnRH signaling pathway
    110304772 (Grb2)
   04915 Estrogen signaling pathway
    110304772 (Grb2)
   04917 Prolactin signaling pathway
    110304772 (Grb2)
   04926 Relaxin signaling pathway
    110304772 (Grb2)
   04935 Growth hormone synthesis, secretion and action
    110304772 (Grb2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110304772 (Grb2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110304772 (Grb2)
  09159 Environmental adaptation
   04714 Thermogenesis
    110304772 (Grb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110304772 (Grb2)
   05206 MicroRNAs in cancer
    110304772 (Grb2)
   05205 Proteoglycans in cancer
    110304772 (Grb2)
   05203 Viral carcinogenesis
    110304772 (Grb2)
   05231 Choline metabolism in cancer
    110304772 (Grb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110304772 (Grb2)
   05225 Hepatocellular carcinoma
    110304772 (Grb2)
   05226 Gastric cancer
    110304772 (Grb2)
   05214 Glioma
    110304772 (Grb2)
   05221 Acute myeloid leukemia
    110304772 (Grb2)
   05220 Chronic myeloid leukemia
    110304772 (Grb2)
   05211 Renal cell carcinoma
    110304772 (Grb2)
   05215 Prostate cancer
    110304772 (Grb2)
   05213 Endometrial cancer
    110304772 (Grb2)
   05224 Breast cancer
    110304772 (Grb2)
   05223 Non-small cell lung cancer
    110304772 (Grb2)
  09165 Substance dependence
   05034 Alcoholism
    110304772 (Grb2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110304772 (Grb2)
   05160 Hepatitis C
    110304772 (Grb2)
   05163 Human cytomegalovirus infection
    110304772 (Grb2)
   05165 Human papillomavirus infection
    110304772 (Grb2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110304772 (Grb2)
   01522 Endocrine resistance
    110304772 (Grb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110304772 (Grb2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcal04990]
    110304772 (Grb2)
Membrane trafficking [BR:mcal04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    110304772 (Grb2)
Domain-containing proteins not elsewhere classified [BR:mcal04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   110304772 (Grb2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_10 SH2_2 SH3_3 hSH3 DUF5093 SH3_4
Other DBs
NCBI-GeneID: 110304772
NCBI-ProteinID: XP_021032018
Ensembl: MGP_CAROLIEiJ_G0017414
UniProt: A0A6P5QTC6
LinkDB
Position
11
AA seq 217 aa
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPW
FFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQMPQQPTYVQALFDFDPQEDGELGFRRG
DFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaagccatcgccaaatatgacttcaaagctactgctgacgatgagctgagcttcaaa
aggggggacatccttaaggttttgaatgaagaatgtgatcagaactggtataaggcagaa
ctcaatgggaaagatggcttcatccccaagaattacatagaaatgaaaccacatccgtgg
ttttttggcaaaatccccagagccaaggcagaagaaatgctcagcaaacagcggcatgac
ggggccttcctgatcagagagagcgagagcgctcctggggacttctccctgtccgtcaag
tttggaaatgatgtgcagcacttcaaggtgctccgcgacggagccgggaagtatttcctg
tgggtggtgaagtttaattctttgaatgagctggtagattaccacagatcaacatccgtg
tccaggaaccagcagatattcttacgggacatagaacagatgccacagcagccaacctac
gtccaggcgctctttgactttgacccccaggaggacggcgagctgggctttcgcagagga
gacttcattcatgtcatggataactcagatcccaattggtggaaaggggcctgccacggg
cagaccggcatgtttccccgcaattatgtcaccccagtgaaccggaacgtctaa

DBGET integrated database retrieval system