KEGG   Mus caroli (Ryukyu mouse): 110304808
Entry
110304808         CDS       T05910                                 

Gene name
Slc2a4
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 4 isoform X1
  KO
K07191  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 4
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04068  FoxO signaling pathway
mcal04152  AMPK signaling pathway
mcal04910  Insulin signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04930  Type II diabetes mellitus
mcal04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110304808 (Slc2a4)
   04152 AMPK signaling pathway
    110304808 (Slc2a4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110304808 (Slc2a4)
   04920 Adipocytokine signaling pathway
    110304808 (Slc2a4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110304808 (Slc2a4)
   04931 Insulin resistance
    110304808 (Slc2a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcal02000]
    110304808 (Slc2a4)
Transporters [BR:mcal02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   110304808 (Slc2a4)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    110304808 (Slc2a4)
SSDB
Motif
Pfam: Sugar_tr MFS_1 Phage_holin_2_3
Other DBs
NCBI-GeneID: 110304808
NCBI-ProteinID: XP_021032074
Ensembl: MGP_CAROLIEiJ_G0016607
UniProt: A0A6P5QP57
LinkDB
Position
11
AA seq 509 aa
MPSGFQQIGSEDGEPPRQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNATW
LGRQGPGGPDSIPQGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAV
LGGALMGLANAAASYEILILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAI
VIGILIAQVLGLESMLGTATLWPLLLALTVLPALLQLILLPFCPESPRYLYIIRNLEGPA
RKSLKRLTGWADVSDALAELKDEKRKLERERPMSLLQLLGSRTHRQPLIIAVVLQLSQQL
SGINAVFYYSTSIFESAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGM
CGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM
AVAGFSNWTCNFIVGMGFQYVADAMGPYVFLLFAVLLLGFFIFTFLKVPETRGRTFDQIS
AAFRRTPSLLEQEVKPSTELEYLGPDEND
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgccgtcgggtttccagcagatcggctctgaagatggggaaccccctcggcagcgagtg
actggaacgctggtcctagctgtattctcagctgtgcttggctcccttcagtttggctat
aacattggggttatcaatgccccacagaaggtgattgaacagagctacaatgcgacgtgg
ctgggtaggcagggtcctgggggaccggattccatcccacaaggcaccctcactacgctc
tgggctctctccgtggccatcttctctgtgggtggcatgatctcttcctttctcattggc
atcatttctcaatggttgggaaggaaaagggctatgctggtcaacaatgtcttggccgtg
ttggggggcgccctcatgggcctagccaatgccgcggcctcctatgagatactcattctc
ggacggttcctcattggcgcttactcagggctaacatcagggttggtgcccatgtatgtg
ggagaaatcgcccccactcatcttcggggtgccttgggaacactcaaccaactggccatc
gtcattggcattctgattgcccaggtgctgggcttggagtctatgctgggcacagctacc
ctgtggccactgcttctggctctcacagtactccctgctctcctgcagctgattctgttg
cccttctgtccagagagccccagatacctctacatcatccggaacctggaggggcctgcc
cgaaagagtctaaagcgcctgaccggctgggctgatgtgtctgacgcactggctgagctg
aaggatgagaaacggaagttggagagagagcgtccgatgtccttgctccagctcctgggc
agccgcacccaccggcagcctctgatcatcgcagtggtgctgcagctgagccaacagctc
tcaggcatcaatgctgttttctactattcaaccagcatcttcgagtcggctggggtggga
cagccagcctacgccaccataggagctggtgtggtcaatacggtcttcacgttggtctcg
gtgctcttagtagaacgagctggacgacggacactccatctgttgggcctggcaggcatg
tgtggctgtgccatcttgatgaccgtggctctgctgctgctggaacgggttccagccatg
agctatgtctccatcgtggccatatttggctttgtggccttctttgagattggccctggc
cccattccctggttcattgtggccgagctcttcagccagggcccccgcccagctgccatg
gctgtcgctggtttctccaactggacctgtaacttcattgtcggcatgggtttccagtat
gttgcggatgctatgggtccctacgtcttccttctatttgccgtcctcctgcttggcttc
ttcatcttcaccttcctaaaagtgcctgaaaccagaggccggacgtttgaccagatctca
gctgccttccgacggacaccttcccttttagagcaggaggtgaaacccagtacagaactt
gaatacttagggccagatgagaatgactga

DBGET integrated database retrieval system