KEGG   Mus caroli (Ryukyu mouse): 110304843
Entry
110304843         CDS       T05910                                 

Gene name
Stat1
Definition
(RefSeq) signal transducer and activator of transcription 1-alpha/beta
  KO
K11220  signal transducer and activator of transcription 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04062  Chemokine signaling pathway
mcal04217  Necroptosis
mcal04380  Osteoclast differentiation
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04630  JAK-STAT signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04917  Prolactin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04935  Growth hormone synthesis, secretion and action
mcal05140  Leishmaniasis
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05212  Pancreatic cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcal05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110304843 (Stat1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110304843 (Stat1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110304843 (Stat1)
   04621 NOD-like receptor signaling pathway
    110304843 (Stat1)
   04625 C-type lectin receptor signaling pathway
    110304843 (Stat1)
   04658 Th1 and Th2 cell differentiation
    110304843 (Stat1)
   04659 Th17 cell differentiation
    110304843 (Stat1)
   04062 Chemokine signaling pathway
    110304843 (Stat1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110304843 (Stat1)
   04935 Growth hormone synthesis, secretion and action
    110304843 (Stat1)
   04919 Thyroid hormone signaling pathway
    110304843 (Stat1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110304843 (Stat1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110304843 (Stat1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110304843 (Stat1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110304843 (Stat1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110304843 (Stat1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110304843 (Stat1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110304843 (Stat1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110304843 (Stat1)
   05160 Hepatitis C
    110304843 (Stat1)
   05171 Coronavirus disease - COVID-19
    110304843 (Stat1)
   05164 Influenza A
    110304843 (Stat1)
   05162 Measles
    110304843 (Stat1)
   05168 Herpes simplex virus 1 infection
    110304843 (Stat1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110304843 (Stat1)
   05169 Epstein-Barr virus infection
    110304843 (Stat1)
   05165 Human papillomavirus infection
    110304843 (Stat1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110304843 (Stat1)
   05140 Leishmaniasis
    110304843 (Stat1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110304843 (Stat1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    110304843 (Stat1)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int STAT1_TAZ2bind SH2 NPV_P10 BLI1
Other DBs
NCBI-GeneID: 110304843
NCBI-ProteinID: XP_021032127
Ensembl: MGP_CAROLIEiJ_G0014128
UniProt: A0A6P7QYA9
LinkDB
Position
1
AA seq 749 aa
MSQWFELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAAYDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPVQMSMIIYNCLKEERKILENAQ
RFNQAQEGNIQNTVMLDKQKELDSKVRNVKDQVMCIEQEIKTLEELQDEYDFKCKTSQNR
EGEANGVAKSDQKQEQLLLHKMFLMLDNKRKEIIHKIRELLNSIELTQNTLINDELVEWK
RRQQSACIGGPPNACLDQLQSWFTIVAETLQQVRQQLKKLEELEQKFTYEPDPITKNKQV
LSDRTFLLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVSFDKDVNEKNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVTE
PRNLSFFLNPPCAWWSQLSEVLSWQFSSVTKRGLNADQLSMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFSFWPWIDTILELIKKHLLCLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDDPKRTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEMSRIVGPEFDSMMSTV
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgtcacagtggttcgagcttcagcagctggactccaagttcctggagcaggtccaccag
ctgtacgatgacagtttccccatggaaatcaggcagtacctggcccagtggctggaaaag
caagactgggagcacgctgcctatgatgtctcgtttgcgaccatccgcttccacgacctc
ctctcgcagctggacgaccagtacagccgcttttctctggagaataatttcttgttgcag
cacaacatacggaaaagcaagcgcaatctccaggataacttccaagaagaccccgtgcag
atgtccatgatcatctacaactgtctgaaggaagaaaggaagattttggaaaatgcccaa
agatttaatcaggcccaggagggaaatattcagaacactgtgatgttggataaacagaag
gagctggacagtaaagtcagaaatgtgaaggatcaagtcatgtgcatagagcaggaaatc
aagaccctagaagaattacaagatgaatatgactttaaatgcaaaacctctcagaacaga
gaaggtgaagccaatggtgtggcgaagagcgaccaaaaacaggaacagctgctgctccac
aagatgtttttaatgcttgacaataagagaaaggagataattcacaaaatcagagagttg
ctgaattccatcgagctcactcagaacactctgattaatgacgagctcgtggagtggaag
cgaaggcagcagagcgcctgcatcgggggaccgcccaacgcctgcctggatcagctgcaa
agctggttcaccattgttgcagagaccctgcagcaggtccgtcagcagcttaaaaagctg
gaggagttggaacagaaattcacctatgagcccgaccctattacaaaaaacaagcaggtg
ttgtcagatcgaaccttcctcctcttccagcagctcattcagagctccttcgtggtagaa
cgacagccgtgcatgcccactcacccgcagaggcccctggtcttgaagactggggtacag
ttcactgtcaagctgagactgttggtgaaattgcaagagctgaactataacttgaaagtg
aaagtctcatttgacaaagatgtgaacgagaaaaacacagtaaaaggatttcggaagttc
aacatcttgggtacgcacacaaaagtgatgaacatggaagaatccaccaacggaagtctg
gcagctgagttccgacacctgcaactgaaggaacagaaaaacgctgggaacagaactaat
gaggggcctctcattgtcaccgaggaacttcactctcttagctttgagacccagttgtgc
cagccaggcttggtgattgacctggagaccacctctcttcctgtcgtggtgatctccaac
gtcagccagctccccagtggctgggcgtctatcctgtggtacaacatgctggtgacagag
ccgaggaatctctccttcttcctgaaccccccgtgcgcgtggtggtcccagctctcagag
gtgttgagttggcagttttcatcagtcaccaagagaggtctgaacgcagaccagctgagc
atgctgggagagaaactgctgggccctaatgctggccccgatggtcttattccatggaca
aggttttgtaaggaaaatattaatgataaaaatttctccttctggccttggattgacacc
atcctagagctcattaagaagcacctgctgtgcctctggaatgatgggtgcattatgggc
ttcatcagcaaggagcgagaacgcgctctgctcaaggaccagcagccagggacgttcctg
cttaggttcagtgagagctcccgggaaggggccatcacattcacatgggtggaacggtcc
cagaacggaggcgaacctgacttccatgcggtggagccctacacgaagaaagaactttca
gctgttactttcccagatattattcgcaactacaaagtcatggctgccgagaatatacca
gagaatcccctgaagtacctgtatcccaatattgacaaagaccatgcctttgggaagtat
tattccagaccaaaggaagcaccagaaccgatggagcttgacgaccctaagcgaactgga
tacatcaagactgagttgatttctgtgtctgaagtccacccttctagacttcagaccaca
gacaacctgcttcccatgtctccagaggagtttgatgagatgtcccggatagtgggcccc
gaatttgacagtatgatgagcacagtataa

DBGET integrated database retrieval system