KEGG   Mus caroli (Ryukyu mouse): 110304844
Entry
110304844         CDS       T05910                                 

Gene name
Llgl2
Definition
(RefSeq) lethal(2) giant larvae protein homolog 2 isoform X1
  KO
K06094  lethal(2) giant larvae protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04390  Hippo signaling pathway
mcal04530  Tight junction
mcal05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110304844 (Llgl2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110304844 (Llgl2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110304844 (Llgl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110304844 (Llgl2)
Membrane trafficking [BR:mcal04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    110304844 (Llgl2)
SSDB
Motif
Pfam: LLGL WD40 Lgl_C
Other DBs
NCBI-GeneID: 110304844
NCBI-ProteinID: XP_021032124
Ensembl: MGP_CAROLIEiJ_G0017418
UniProt: A0A6P7RIS6
LinkDB
Position
11
AA seq 1028 aa
MRRFLRTGHDPARERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAVKLYG
APGVEFMGLHKENNAVLQIHFLPGQCQLVTLLDDNSLHLWSLKVKGGVSELQEEESFILR
GPPGSAPSATQVTEILPHSSGELLYLGTESGNVFVVQLPGFRTLHDRTICSDEVLQWLPE
EARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLRGSRALGHFLSSQQLENASWQR
DGCLIVTCHSDGSHCQWPVSSDTQNPEPLRSSIPYGPFPCKAITKIFWLTTRQGLPFTIF
QGGMPRASYGDRHCISVVHNGQQTAFDFTSRVIDFTVLSEADPAAAFDDPYALVVLAEEE
LVVIDLQTPGWPPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQNSHFSTMEW
PIDGGTSLAPPPPQRDLLLTGHEDGTVRFWDASGVCLRLLYKLSTVRVFLTDTDLSENLS
AQGEDEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEH
AVEQVEADLLQDQEGYRWKGHERLAARPGPVCFEAGFQPFVLVQCQPPAVVTSLALHSEW
RLVAFGTSHGFGLFDHQQRRQVFVKCTLHPSDQLALEGPLSRVKSLKKSLRQSFRRMRRS
RVSSHKRRPGGPTGEAQAQAVNTKAERTGLQNMELAPVQRKIEARSAEDSFTGFVRTLYF
ADTYLRDSSRHCPSLWAGTNGGTVYAFSLRVPPAERRTDEPVRAEQAKEIQLMHRAPVVG
ILVLDGHNVPLPEPLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTAL
EGSRVRRVGVAHFGSCRAEDYGEHHLAVLTNLGDIQVVSMPLLKPQVRYSCIRREDVSGI
ASCVFTKHGQGFYLISPSEFERFSLSTKWLVEPRCLVDSTKAKKHNRPSNGNGTGPKMTS
SGHVRNSRSQSDGDEKKPGPVMEHALLNDASGVLKEIQSTLEGDRGSYGNWHPHRVAVGC
RLSNGEAE
NT seq 3087 nt   +upstreamnt  +downstreamnt
atgaggcggttcctgagaactggacatgaccctgcccgggagaggctgaagcgggatctg
ttccagtttaacaagacggtggagcatggcttcccacaccagcccagcgcccttggctat
agcccttcgctgcgcatcctggccataggaacccgctctggagctgtcaagctatatggt
gcccctggggtagagttcatgggccttcacaaggagaacaatgcagtgctgcagatccac
ttcctgcctggtcagtgtcagctggtcactctgctggatgacaacagcctgcacctgtgg
agcctgaaggtcaagggcggggtgtcagagctgcaggaagaagagagcttcatattgcgt
ggccccccagggtctgcccccagtgccacgcaggtcactgagattctacctcactcttcc
ggagaactgctctacctgggcaccgagagcggcaacgtgtttgtggtgcagctcccgggg
ttccgcacgctgcacgacaggaccatctgttcagacgaggtgctgcaatggttgccagag
gaggctcgccaccggcgagtgtttgagatggtggaggctctgcaggagcaccctcgagac
cccaaccaaatcctcattggctacagccgaggcctcgtcgtcatctgggaccttcggggc
agccgagcgctcggtcatttcctcagcagccagcaactggagaatgccagctggcagcgg
gatggctgcctgattgtcacctgccactccgacggcagccactgccagtggcccgtgtcc
agtgacacccagaacccagaacctctgcgcagctctataccttacggtccctttccttgc
aaagctataacgaaaatcttctggctcaccaccaggcaagggttgcccttcaccatcttc
cagggcggtatgccacgggccagttatggggaccgccactgcatctcagtggtccacaac
ggccagcagacggccttcgacttcacctcccgtgtcattgacttcactgttctctcagag
gctgaccctgcggctgcctttgatgacccctatgccctggtggtgctagccgaggaggaa
ctggtggtcattgacctgcagacacctggctggccaccagtccagctgccctacctggct
tccttgcactgttctgccatcacctgctcccaccacgtctccaacatccccctgaagcta
tgggaacgcatcatcgccgcgggcagccgccagaactcacacttttccaccatggagtgg
cccatagatggtggcaccagcctggccccaccgccaccccagagggacctgctgctcaca
gggcacgaggatggcactgtgcggttctgggatgcctcgggtgtgtgcttacgactgctc
tacaaactgagcactgtgagggtgttcctcacagacacggacctcagtgagaatctcagt
gcccagggtgaggacgagtggcccccactccgcaaggtgggctcctttgatccctacagc
gatgatccgcggctgggcatccagaagattttcctctgcaaatacagcggctacctggct
gtggcaggcacggcagggcaggtgctggtgctggagttgaacgatgaggcggccgagcat
gccgtggagcaggtggaggctgacctgctgcaggaccaggagggttaccgctggaagggg
cacgagcgcctcgccgcccgcccggggcccgtgtgctttgaggcgggatttcagcccttt
gtactggtgcagtgccagcccccagctgtggtcacctccttggctctgcactctgagtgg
cggcttgtggcctttggcaccagccatggtttcggcctcttcgatcaccagcaacggcga
caggtctttgtcaagtgcacacttcaccccagtgaccagctggccttggagggccctctg
tctcgagtaaagtccctcaagaagtctctgcgccagtcattccgtcggatgcgccgcagc
agagtgtccagtcataaacggcggcctggtggccccacaggcgaggcgcaggcccaggct
gtgaacaccaaggctgagcggacgggcctgcagaacatggagttggcgcctgtgcaacgg
aagattgaggcccgctccgcggaggactccttcaccggctttgttcggaccctttatttc
gctgatacctacctgagggacagctcccgccactgtccctccctgtgggctggcaccaac
ggaggcaccgtctacgccttttccctgcgcgtgcctcctgcagaaagaagaacggatgaa
cctgtccgggcagagcaggccaaggagatccagttaatgcaccgcgcgcctgtggtgggc
atcctggtgctcgacgggcacaatgtacccctccccgagcccctggaagtggcccacgac
ctgtcgaagagcccagacatgcaagggagccaccaattgcttgtggtgtcggaggagcaa
ttcaaggtattcacactgcccaaggtgagcgccaaactgaagctgaagctgacggccctg
gagggctcacgggtgcggcgagtcggtgtcgcccactttggcagctgcagggctgaggac
tatggggagcaccacctggcagtgctcaccaacttgggtgacatccaggtggtctcaatg
cccctgctcaagccccaggtgcggtacagctgcatccgccgggaggacgtcagcggcata
gcctcctgtgtcttcaccaagcatggccaaggtttctatctgatatcaccttcggagttc
gagcgcttttctctctccaccaagtggctggttgagccccggtgtttggtggattcaacc
aaagccaagaagcacaaccggcccagcaatggcaatggcacgggccccaaaatgacctcc
tcaggccacgtcaggaactcaaggagccaaagtgatggagatgagaagaagccgggccca
gtgatggagcacgcgctactcaatgacgcctcaggggtcctaaaggaaatccagagcacg
ctggagggggaccgggggagctatggcaattggcatcctcaccgtgtggctgtgggttgc
aggctcagcaatggagaagcagagtga

KEGG   Mus caroli (Ryukyu mouse): 110305811
Entry
110305811         CDS       T05910                                 

Gene name
Llgl1
Definition
(RefSeq) lethal(2) giant larvae protein homolog 1 isoform X1
  KO
K06094  lethal(2) giant larvae protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04390  Hippo signaling pathway
mcal04530  Tight junction
mcal05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110305811 (Llgl1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110305811 (Llgl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110305811 (Llgl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110305811 (Llgl1)
Membrane trafficking [BR:mcal04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    110305811 (Llgl1)
SSDB
Motif
Pfam: LLGL Lgl_C WD40
Other DBs
NCBI-GeneID: 110305811
NCBI-ProteinID: XP_021033593
Ensembl: MGP_CAROLIEiJ_G0016459
UniProt: A0A6P5QWP1
LinkDB
Position
11
AA seq 1062 aa
MMKFRFRRQGADPQREKLKQELFAFHKTVEHGFPNQPSALAFDPELRIMAIGTRSGAVKI
YGAPGVEFTGLHRDAATVTQMHFLPGQGRLLTLLDDSSLHLWEIIHHNGCAHLEEGLSFH
PPSRPSFDNASFPASLTRVTVVLLVAGNTAALGTESGSIFFLDVATLALLEGQTLSPDVV
LRSVPDDYRCGKALGPVESLQGHLQDPSKILIGYSRGLLVIWSQATQSVDNVFLGNQQLE
SLCWGRDGSSIISSHSDGSYAIWSTDTGSPPTLQPTVVTTPYGPFPCKAINKILWRSCES
GDHFIIFSGGMPRASYGDRHCVSVLRAETLVTLDFTSRVIDFFTVHSTQPEDECDNPQAL
AVLLEEELVVLDLQTPGWPAVPAPYLAPLHSSAITCSAHVANVPSKLWARIVSAGEQQSP
QPASSALSWPITGGRNLAQEPSQRGLLLTGHEDGTVRFWDASGVALRPLYKLSTAGLFQT
DCEHADSLAQAVEDDWPPFRKVGCFDPYSDDPRLGIQKVALCKYTAQMVVAGTAGQVLVL
ELSEVPAEHAVSVANVDLLQDREGFTWKGHERLNPHTGLLPWPAGFQPRMLIQCLPPAAV
TAVTLHAEWSLVAFGTSHGFGLFDYQRKSPVLARCTLHPNDSLAMEGPLSRVKSLKKSLR
QSFRRIRKSRVSGKKRTPAASSKLQEANAQLAEQTCPHDLEMTPVQRRIEPRSADDSLSG
VVRCLYFADTFLRDATHHGPTMWAGTNSGSVFAYALEVPAAAAGGEKRPEQAVEAVLGKE
VQLMHRAPVVAIAVLDGRGRPLPEPYEASRDLAQAPDMQGGHAVLIASEEQFKVFTLPKV
SAKTKFKLTAHEGCRVRKVALATFASVMSEDYAETCLACLTNLGDVHVFSVPGLRPQVHY
SCIRKEDISGIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDISWPQNATQPR
LQESPKLSQANGTRDIILAPESCEGSPNSAHSKRADTMEPPEATLSPVSIDSAASGDTML
DTTGDVTVEYVKDFLGSPEDSEKNLRNLEADDACRAYTLLIK
NT seq 3189 nt   +upstreamnt  +downstreamnt
atgatgaagtttcggttccggcggcagggcgccgacccgcagcgcgagaagctcaagcag
gagctctttgccttccacaagactgtggagcatggcttccccaatcagcccagtgccttg
gccttcgaccctgagctccgcatcatggccatcggcaccaggtctggggccgtcaagatc
tatggtgcacccggagtggaatttacaggcctacatcgggacgcggctaccgtcacccag
atgcatttcctccctggtcagggccgcctcctgaccctgctagatgacagcagcttgcat
ctctgggagatcatccatcataatggctgtgcccacctggaggaaggcctcagcttccac
ccacccagcagacccagttttgacaatgccagtttccctgccagtctaacacgtgtcact
gtggtcctgctcgtagctggcaatacagcagccctgggaaccgagagtggtagcatattc
ttcctggatgtagccaccctggcactgctggaggggcagactctcagcccagatgttgtt
ctgcgcagtgtgccagatgactaccggtgtggaaaggccttgggccctgtggagtcactc
cagggacatctgcaagaccccagcaagatcctcataggctacagtcggggcttactggtc
atctggagccaggccacacagtctgtggacaacgttttcctaggtaaccagcagctggag
agcctgtgttggggccgtgatggcagcagcattatcagctcacacagtgatggcagctat
gccatctggtccacagacactggcagccccccaacgctgcagcccactgtagtgaccaca
ccctacggccccttcccctgcaaggccatcaacaagattctgtggcggagctgtgagtca
ggagaccactttatcatcttcagtggtggcatgcctcgagccagctatggtgaccgccac
tgtgtgagtgtactgcgagcagagacactggtgaccctggacttcacctcccgtgtcatt
gacttcttcacggtgcacagcacacagccagaggatgagtgtgataacccccaggcccta
gccgtgcttctggaggaggagctggtagtgctggacctgcagacaccaggctggccagct
gtgcccgccccttacctggccccactgcattcgtcagctatcacctgctctgcccatgtt
gccaatgtccccagcaagctgtgggcccgcattgtaagtgctggtgagcagcagagccca
cagcctgcctctagtgccttgagttggcccattaccgggggccggaacttggcccaggaa
ccctcgcagcgtgggctgctgctcaccggccatgaggatggcactgtgcggttctgggac
gcctctggtgtggcgctaaggccactctacaaactgagcacagctggcctcttccagacg
gactgtgaacatgctgacagcctggcccaggctgtggaggatgactggccgcccttccgc
aaggtgggctgctttgatccctacagtgatgacccccggctaggaatccagaaggttgcg
ctttgcaagtacacagcccagatggtggtagctggcactgcaggccaggtgctggtgctg
gagctcagtgaggtcccagcagagcatgccgtcagtgtggccaacgtggatctacttcag
gatcgcgagggcttcacgtggaagggtcacgagcggctgaacccacacacggggctgctg
ccatggcctgccggattccagccccgcatgttgatacagtgcctcccacccgctgctgtc
actgctgtcacactccatgctgagtggagcctcgtggcctttggtaccagtcatggcttt
ggcctttttgactaccagcgcaagagccctgtgctggctaggtgcacccttcaccccaat
gactctttggccatggaggggccactgtcacgagtgaagtccctcaagaagtcactgcga
cagtcattccggcgaatccgcaagagccgtgtctcaggcaaaaaacggactcctgctgcc
agtagcaagttgcaggaggccaatgcccagctggccgagcagacttgcccacacgacctg
gagatgacacccgtgcagcgccgcattgagcctcggtctgctgacgactcgctctctggt
gttgtacgctgcctctacttcgctgacacgttccttcgagatgcgacccaccacgggccc
accatgtgggccggcaccaactcgggctctgtgttcgcctatgcgctggaggttccagca
gccgcagcaggtggagagaagcggcctgagcaggcagtggaggctgtgctgggcaaggag
gtgcagctaatgcaccgagcacctgtggtggccattgctgtgctggatggtcgtggccgg
ccgctgcctgagccctacgaggcttcccgggacctggcccaggcgccagacatgcaaggc
ggccatgctgtgctcattgcgtctgaggaacaattcaaggtgttcacactacccaaggtg
agtgctaagactaaattcaagctgacagcccatgaaggctgtcgtgtgcggaaggtagcc
ctggctacatttgccagtgtgatgtctgaggactatgccgagacctgccttgcctgcctc
accaacctgggtgatgtccatgtcttctcggtgcctggcctgaggcctcaggtgcactac
tcctgtatccggaaggaggacatcagtggcatcgcttcctgtgtcttcacacgtcacggc
cagggcttttacttgatttctccatcggaatttgagcgcttctcactgagtgctcgcaac
atcacggaaccactctgttctctggatataagctggccccaaaatgccacccagcccagg
cttcaagagtcacccaagctgagccaggctaatgggaccagagacatcattctggcccca
gagagctgcgaaggaagccctaactctgcccacagcaagcgagctgataccatggaacca
cccgaggccactctctcgcctgtgtccattgattcagctgctagtggggataccatgctg
gacacgacaggggatgtcaccgtggaatatgtgaaggattttctgggctctcctgaggac
tctgagaagaacctacggaacctggaggcagatgatgcctgtcgggcctacacccttctg
attaaatga

DBGET integrated database retrieval system