KEGG   Mus caroli (Ryukyu mouse): 110305003
Entry
110305003         CDS       T05910                                 

Gene name
Jup
Definition
(RefSeq) junction plakoglobin
  KO
K10056  junction plakoglobin
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05221  Acute myeloid leukemia
mcal05226  Gastric cancer
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110305003 (Jup)
   05202 Transcriptional misregulation in cancer
    110305003 (Jup)
  09162 Cancer: specific types
   05226 Gastric cancer
    110305003 (Jup)
   05221 Acute myeloid leukemia
    110305003 (Jup)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110305003 (Jup)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110305003 (Jup)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110305003 (Jup)
SSDB
Motif
Pfam: Arm HEAT V-ATPase_H_N Cnd1 HEAT_2 Adaptin_N Atx10homo_assoc DUF3361 Arm_2 PUL
Other DBs
NCBI-GeneID: 110305003
NCBI-ProteinID: XP_021032396
Ensembl: MGP_CAROLIEiJ_G0017169
UniProt: A0A6P7REM8
LinkDB
Position
11
AA seq 745 aa
MEVMNLIEQPIKVTEWQQTYTYDSGIHSGVNTCVPSVSSKGIMDEDDACGRQYTLKKTTT
YTQGVPQNQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQTTNLQRLAEPS
QLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALM
GSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVE
SVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQ
ESKLIILANGGPQGLVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKH
LTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTC
NNSKNKMLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNY
GIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQR
HVAAGTQQPYTDGVRMEEIVEGCTGALHILARDSMNRMEIFRLNTIPLFVQLLYSSVENI
QRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDY
RKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYADDMDATYRPMYSSDVPLDPLDMHMDM
DGDYPMDTYSDGLRPPYPTADHMLA
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggaggtgatgaaccttattgagcagcccatcaaggtgacagagtggcagcagacatac
acctacgactcgggcatccactccggcgtcaatacctgtgtgccctctgtaagcagcaag
ggcatcatggatgaggatgatgcctgcggccgacagtacacactcaagaagactaccacc
tatacacaaggggtgccacagaaccaaggtgacctggagtaccagatgtccacgacggcc
agagccaagcgggtgcgagaggccatgtgtccaggggtctcaggcgaggacagttctcta
ctgctggccacccaggtggaggggcagacgaccaatctgcagcgcctggccgagccatcc
cagttgctcaagtcggccattgttcatctcatcaactaccaggatgatgcagagctggcc
acccgggctctgcctgagctcaccaagctgctcaacgatgaggacccggtagtggtgacc
aaggcggctatgatcgtgaaccagctgtccaagaaggaggcatcccgccgggctctaatg
ggctcgccgcagctggtggcggcggtggtacggaccatgcagaacaccagtgacctggat
actgcccggtgtaccaccagcatcctgcacaacctctcccaccaccgagagggcttgctc
gccatcttcaagtctggaggcatccctgccctagtccgaatgctcagttcccccgtagag
tctgtcctgttctacgccatcaccacactgcacaacctgctgctctatcaggagggcgcc
aagatggcggtgcgtctggcagacgggctgcagaagatggtgcccctactcaacaagaac
aaccctaagttcctggccatcaccactgactgcctgcagctcctggcctatggcaaccag
gagagcaagctgatcatcctggccaatgggggaccccaagggcttgtgcagatcatgagg
aactacagctatgagaagcttctgtggaccaccagccgtgtgctcaaggtgctctccgtg
tgtcctagcaacaagcctgccatcgtggaggctggtgggatgcaggctctgggcaagcac
ttgacaagcaacagcccccgcctggtgcagaactgcctgtggactctgcgcaatctctca
gatgtggccaccaagcaggagggcctggagagtgtgctgaagatcctggtcaaccaactg
agtgtagatgacgtcaacgtcctcacctgtgccacgggcaccctctccaacctgacctgc
aacaacagcaaaaacaagatgctggtgacacagaacagtggcgtggaggcgctcatccac
gccatcctgagagccggagacaaagatgacatcacagagcccgccgtctgtgccctgcgc
caccttactagccgtcaccccgaggctgagatggcccagaactctgtgcgcctcaactat
ggaatcccggccattgtgaaactgctcaaccagccaaaccagtggccactggtcaaggca
actattggcctgatccggaacctggctctgtgcccagccaaccatgcccctctgcaggag
gccgcggtcattccccgcctcgtccagctgttggtcaaggcccaccaggatgcccagcgc
catgtggctgcaggtacccagcagccctacacggatggtgtgaggatggaggaaatcgtg
gaaggctgcaccggagccctgcacatccttgcccgggattccatgaaccgcatggagatc
ttccggctcaacaccattcccctgtttgtccagctcctgtactcctctgtggagaacatc
cagcgtgtggctgcgggagtgctctgcgagctggcccaggacaaggaggctgccgatgcc
attgatgcggagggcgcctctgcccctctcatggaactactccattcccgcaatgagggc
accgcgacctatgctgctgctgtcctgttccgcatctctgaggacaagaacccagattac
cgtaaacgagtgtctgtggaactcaccaactccctcttcaagcatgacccagctgcctgg
gaagctgcccagagtatgatcccgatcaacgaaccctatgcagacgacatggatgccacc
taccgccccatgtactccagcgatgtgcctctggaccctctggacatgcacatggacatg
gatggagactaccccatggacacctacagtgacggcctgaggcctccctaccccactgca
gaccacatgctggcctag

DBGET integrated database retrieval system