KEGG   Mus caroli (Ryukyu mouse): 110305072
Entry
110305072         CDS       T05910                                 

Gene name
Itgb3
Definition
(RefSeq) integrin beta-3
  KO
K06493  integrin beta 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04015  Rap1 signaling pathway
mcal04145  Phagosome
mcal04151  PI3K-Akt signaling pathway
mcal04380  Osteoclast differentiation
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal04611  Platelet activation
mcal04640  Hematopoietic cell lineage
mcal04810  Regulation of actin cytoskeleton
mcal04919  Thyroid hormone signaling pathway
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05410  Hypertrophic cardiomyopathy
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
mcal05414  Dilated cardiomyopathy
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110305072 (Itgb3)
   04151 PI3K-Akt signaling pathway
    110305072 (Itgb3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110305072 (Itgb3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110305072 (Itgb3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110305072 (Itgb3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110305072 (Itgb3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110305072 (Itgb3)
   04611 Platelet activation
    110305072 (Itgb3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110305072 (Itgb3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110305072 (Itgb3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    110305072 (Itgb3)
   05205 Proteoglycans in cancer
    110305072 (Itgb3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110305072 (Itgb3)
   05410 Hypertrophic cardiomyopathy
    110305072 (Itgb3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110305072 (Itgb3)
   05414 Dilated cardiomyopathy
    110305072 (Itgb3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110305072 (Itgb3)
   05163 Human cytomegalovirus infection
    110305072 (Itgb3)
   05165 Human papillomavirus infection
    110305072 (Itgb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110305072 (Itgb3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110305072 (Itgb3)
   04515 Cell adhesion molecules [BR:mcal04515]
    110305072 (Itgb3)
   04090 CD molecules [BR:mcal04090]
    110305072 (Itgb3)
Membrane trafficking [BR:mcal04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    110305072 (Itgb3)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110305072 (Itgb3)
Cell adhesion molecules [BR:mcal04515]
 Integrins
  Integrin beta subunits
   110305072 (Itgb3)
CD molecules [BR:mcal04090]
 Proteins
  110305072 (Itgb3)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 110305072
NCBI-ProteinID: XP_021032507
Ensembl: MGP_CAROLIEiJ_G0017295
UniProt: A0A6P5QUE5
LinkDB
Position
11
AA seq 787 aa
MRAQWPGQLWAALLALGALAGVVVGESNICTTRGVNSCQQCLAVSPVCAWCSDETLSQGS
PRCNLKENLLKDNCAPESIEFPISEAQILEARPLSSKGSGSSAQITQVSPQRIALRLRPD
DSKIFSLQVRQVEDYPVDIYYLMDLSFSMKDDLSSIQTLGTKLASQMRKLTSNLRIGFGA
FVDKPVSPYMYISPPQAIKNPCYNMKNACLPMFGYKHVLTLTDQVSRFNEEVRKQSVSRN
RDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVLPNDGRCHI
GTDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVSLYQNYSELIPGTTVGVLSD
DSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTV
SFSIEAKVRGCPQEKEQSFTIKPVGFKDSLTVQVTFDCDCACQAFAQPSSPRCNNGNGTF
ECGVCRCDQGWLGSMCECSEEDYRPSQQEECSPKEGQPICSQRGECLCGQCVCHSSDFGK
ITGKYCECDDFSCVRYKGEMCSGHGQCNCGDCVCDSDWTGYYCNCTTRTDTCMSTNGLLC
SGRGNCECGSCVCVQPGSYGDTCEKCPTCPDACSFKKECVECKKFNRGTLHEENTCSRYC
RDDIEQVKELTDTGKNAVNCTYKNEDDCVVRFQYYEDTSGRAVLYVVEEPECPKGPDILV
VLLSVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFT
NITYRGT
NT seq 2364 nt   +upstreamnt  +downstreamnt
atgcgagcgcagtggccgggacaactctgggccgctctgctggcgctgggggcgctggcg
ggcgttgtcgttggagagtccaacatctgtaccacacgaggcgtgaactcctgccagcag
tgtctggctgtgagtcctgtgtgtgcctggtgctcagatgagactttgtctcagggctca
ccccgatgtaacctgaaggagaacctgctgaaggataactgtgctccagagtctattgag
ttcccaatcagtgaggcccagatcctggaggctaggccactcagcagcaagggctctgga
agcagcgcccagatcactcaagtcagcccccagaggattgctcttcgactacggccagat
gattcgaagatcttctcacttcaagtgcggcaggtggaggattaccccgtggacatctac
tacttgatggacctgtctttctccatgaaggatgatctgtccagcatccagaccctgggt
accaagttggcctctcagatgcgcaagcttactagcaaccttcggattggctttggggcc
ttcgtggacaagcctgtatcgccgtacatgtacatctccccaccgcaggcaatcaaaaac
ccctgttacaatatgaagaatgcctgcttgcccatgtttggctacaaacacgtgctgaca
ctaaccgaccaggtgtcccgcttcaatgaagaagtgaggaaacagagtgtgtcccgtaat
cgagatgccccagagggcggctttgatgccatcatgcaggctacagtgtgtgatgaaaaa
attggctggaggaatgacgcatcccatttgctagtgtttaccacggatgccaagacccat
attgccctggatggaaggctggcaggcattgtcctgcccaatgatgggcgctgtcacatt
ggcaccgacaaccactactctgcctccactaccatggattacccatccctggggctgatg
actgagaaactatcccagaaaaacattaacttgatctttgcagtgactgaaaatgtcgtc
agcctttaccagaattatagtgagctcattcccgggaccacagtgggagtcctgtctgat
gactcaagcaatgtcctccagctcattgttgatgcttacgggaaaatccgctctaaagtg
gagctggaagtacgtgacctgccggaagaactgtcactgtccttcaatgccacctgcctc
aacaacgaggttatcccaggcctcaagtcttgtgtgggcctcaagattggagacacggtg
agctttagtatcgaggccaaggtgcgtggctgcccccaggagaaggagcagtctttcact
atcaagcctgtgggctttaaggacagcctcaccgtccaggtgaccttcgactgtgactgt
gcctgccaggcctttgcccagccttccagcccacgctgcaacaatgggaacgggactttt
gaatgtggggtgtgccgctgtgaccagggctggctggggtccatgtgtgagtgctctgag
gaggattaccgaccctctcagcaggaagagtgcagccccaaggagggccagcccatctgc
agccagcggggagagtgcctctgtggccagtgtgtctgccacagcagtgacttcggcaag
atcactggcaagtactgtgagtgcgatgacttctcctgcgtccgctacaaaggggagatg
tgttccggccatgggcagtgtaactgtggggactgcgtgtgtgactcggactggactggc
tactactgcaactgcactacacgcactgacacctgcatgtccaccaatgggctgctgtgc
agcggccggggcaactgcgagtgcggcagctgtgtgtgtgtccagccaggctcctatgga
gacacctgtgagaagtgccccacctgcccagatgcctgctcctttaagaaggagtgtgtg
gagtgtaagaagttcaaccgggggacgctccatgaagaaaacacctgcagccgatactgc
cgggatgacatcgagcaggtgaaagagctgacggataccggcaaaaacgcggtgaattgt
acctacaagaacgaggatgactgtgtcgtcagattccagtactacgaagacaccagtggg
agggcagtcctctatgtggtggaagagcctgagtgtcccaagggtcctgatatcctggtg
gtcctgctgtcagtgatgggggccatcctgctcattggccttgctactctgctcatctgg
aagctactcatcaccatccatgaccggaaggaatttgctaaatttgaggaagaacgagcc
agagccaagtgggacacagcaaacaacccgctgtataaagaggccacctccaccttcacc
aatatcacctaccgggggacttaa

DBGET integrated database retrieval system