KEGG   Mus caroli (Ryukyu mouse): 110305233
Entry
110305233         CDS       T05910                                 

Gene name
Crk
Definition
(RefSeq) adapter molecule crk isoform X1
  KO
K04438  C-crk adapter molecule crk
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04015  Rap1 signaling pathway
mcal04062  Chemokine signaling pathway
mcal04510  Focal adhesion
mcal04666  Fc gamma R-mediated phagocytosis
mcal04722  Neurotrophin signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal04910  Insulin signaling pathway
mcal04935  Growth hormone synthesis, secretion and action
mcal05100  Bacterial invasion of epithelial cells
mcal05135  Yersinia infection
mcal05163  Human cytomegalovirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05206  MicroRNAs in cancer
mcal05211  Renal cell carcinoma
mcal05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110305233 (Crk)
   04012 ErbB signaling pathway
    110305233 (Crk)
   04015 Rap1 signaling pathway
    110305233 (Crk)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110305233 (Crk)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110305233 (Crk)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    110305233 (Crk)
   04062 Chemokine signaling pathway
    110305233 (Crk)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110305233 (Crk)
   04935 Growth hormone synthesis, secretion and action
    110305233 (Crk)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110305233 (Crk)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110305233 (Crk)
   05206 MicroRNAs in cancer
    110305233 (Crk)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    110305233 (Crk)
   05211 Renal cell carcinoma
    110305233 (Crk)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110305233 (Crk)
   05100 Bacterial invasion of epithelial cells
    110305233 (Crk)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110305233 (Crk)
   05163 Human cytomegalovirus infection
    110305233 (Crk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcal04990]
    110305233 (Crk)
Domain-containing proteins not elsewhere classified [BR:mcal04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   110305233 (Crk)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 110305233
NCBI-ProteinID: XP_021032738
Ensembl: MGP_CAROLIEiJ_G0016747
UniProt: A0A6P5QUW0
LinkDB
Position
11
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVAK
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcgggcaacttcgactcggaggagcggagtagctggtactggggccgcttgagccgg
caggaggcggtggcgctattgcagggccagcggcacggggtgttcctggtgcgggactcg
agcaccagccccggggactatgtgcttagcgtctccgaaaactcgcgcgtctcccactac
atcatcaacagcagcggcccgcgccctccagtgcctccgtcgcccgctcagcctccgccg
ggagtgagtccctccaggctccgaataggagatcaagaatttgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacattgatagaaccagtggccaaa
tcaaggcagggtagtggagtgattctcaggcaggaggaggcagagtatgtgcgggccctc
tttgactttaatgggaatgatgaagaagatcttccctttaagaaaggagacatcctgaga
atccgggataagcctgaagagcagtggtggaatgcagaggacagcgaaggaaagaggggg
atgattcctgtcccttacgtggagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcctgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatttatgcc
agggttatccagaagcgagtccctaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcccgat
gaggacttcagctga

KEGG   Mus caroli (Ryukyu mouse): 110311596
Entry
110311596         CDS       T05910                                 

Gene name
Crkl
Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04015  Rap1 signaling pathway
mcal04062  Chemokine signaling pathway
mcal04510  Focal adhesion
mcal04666  Fc gamma R-mediated phagocytosis
mcal04722  Neurotrophin signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal04910  Insulin signaling pathway
mcal04935  Growth hormone synthesis, secretion and action
mcal05100  Bacterial invasion of epithelial cells
mcal05135  Yersinia infection
mcal05163  Human cytomegalovirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05206  MicroRNAs in cancer
mcal05211  Renal cell carcinoma
mcal05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110311596 (Crkl)
   04012 ErbB signaling pathway
    110311596 (Crkl)
   04015 Rap1 signaling pathway
    110311596 (Crkl)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110311596 (Crkl)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110311596 (Crkl)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    110311596 (Crkl)
   04062 Chemokine signaling pathway
    110311596 (Crkl)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110311596 (Crkl)
   04935 Growth hormone synthesis, secretion and action
    110311596 (Crkl)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110311596 (Crkl)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110311596 (Crkl)
   05206 MicroRNAs in cancer
    110311596 (Crkl)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    110311596 (Crkl)
   05211 Renal cell carcinoma
    110311596 (Crkl)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110311596 (Crkl)
   05100 Bacterial invasion of epithelial cells
    110311596 (Crkl)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110311596 (Crkl)
   05163 Human cytomegalovirus infection
    110311596 (Crkl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcal04990]
    110311596 (Crkl)
Domain-containing proteins not elsewhere classified [BR:mcal04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   110311596 (Crkl)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 hSH3
Other DBs
NCBI-GeneID: 110311596
NCBI-ProteinID: XP_021040645
Ensembl: MGP_CAROLIEiJ_G0020515
UniProt: A0A6P5RCT0
LinkDB
Position
16
AA seq 303 aa
MSSARFDSSDRSAWYMGPVTRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPVGSVSAPNLPT
AEENLEYVRTLYDFPGNDAEDLPFKKGELLVIIEKPEEQWWSARNKEGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPTVASTPGAAINPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD
DNE
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcctccgccaggtttgattcttcagaccgctctgcctggtacatggggccagtgact
cgccaggaggcgcagactcgtctccagggccagcgccatggcatgttcctagtccgggac
tcatctacctgccccggggactatgtactgtccgtgtccgagaactcgcgtgtctcgcac
tacatcatcaactccctgcccaaccgccgctttaagatcggggaccaggagtttgaccat
ttgccggccttgctggagttctacaagatccactatctggacactaccaccttaatcgaa
ccggcgcccaggtacccaagcccaccagtgggttctgtctcagcacccaacttacctaca
gcagaagaaaatctggaatatgtacggaccctgtatgattttcctgggaatgatgctgaa
gacctaccctttaaaaagggcgagcttctagtgataatagaaaagcctgaagagcagtgg
tggagtgcccgcaacaaggaaggccgggttgggatgattcctgtcccttacgttgaaaag
cttgtgaggtcgtcgccacatggaaagcatggaaataggaattctaacagttatggcatc
ccagaacctgctcatgcgtatgctcaacctcagaccacaactcctctacctacagttgcc
agtactcctggggcagcgatcaaccctttgccatccacacagaatggacctgtctttgca
aaagcaatccagaagagagtaccttgtgcttatgacaagactgccttggcattggaggtt
ggtgacattgtgaaagtcacaaggatgaatatcaatggccaatgggaaggcgaggtgaat
gggcgcaaggggcttttccccttcacacatgttaaaatctttgatcctcagaaccccgat
gacaatgagtga

DBGET integrated database retrieval system