KEGG   Mus caroli (Ryukyu mouse): 110305297
Entry
110305297         CDS       T05910                                 

Gene name
Tp53
Definition
(RefSeq) cellular tumor antigen p53 isoform X1
  KO
K04451  tumor protein p53
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal01524  Platinum drug resistance
mcal04010  MAPK signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04110  Cell cycle
mcal04115  p53 signaling pathway
mcal04137  Mitophagy - animal
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04211  Longevity regulating pathway
mcal04216  Ferroptosis
mcal04218  Cellular senescence
mcal04310  Wnt signaling pathway
mcal04722  Neurotrophin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal05012  Parkinson disease
mcal05014  Amyotrophic lateral sclerosis
mcal05016  Huntington disease
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05203  Viral carcinogenesis
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05216  Thyroid cancer
mcal05217  Basal cell carcinoma
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05220  Chronic myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110305297 (Tp53)
   04310 Wnt signaling pathway
    110305297 (Tp53)
   04071 Sphingolipid signaling pathway
    110305297 (Tp53)
   04151 PI3K-Akt signaling pathway
    110305297 (Tp53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110305297 (Tp53)
  09143 Cell growth and death
   04110 Cell cycle
    110305297 (Tp53)
   04210 Apoptosis
    110305297 (Tp53)
   04216 Ferroptosis
    110305297 (Tp53)
   04115 p53 signaling pathway
    110305297 (Tp53)
   04218 Cellular senescence
    110305297 (Tp53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110305297 (Tp53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110305297 (Tp53)
  09149 Aging
   04211 Longevity regulating pathway
    110305297 (Tp53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110305297 (Tp53)
   05202 Transcriptional misregulation in cancer
    110305297 (Tp53)
   05206 MicroRNAs in cancer
    110305297 (Tp53)
   05205 Proteoglycans in cancer
    110305297 (Tp53)
   05203 Viral carcinogenesis
    110305297 (Tp53)
   05230 Central carbon metabolism in cancer
    110305297 (Tp53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110305297 (Tp53)
   05212 Pancreatic cancer
    110305297 (Tp53)
   05225 Hepatocellular carcinoma
    110305297 (Tp53)
   05226 Gastric cancer
    110305297 (Tp53)
   05214 Glioma
    110305297 (Tp53)
   05216 Thyroid cancer
    110305297 (Tp53)
   05220 Chronic myeloid leukemia
    110305297 (Tp53)
   05217 Basal cell carcinoma
    110305297 (Tp53)
   05218 Melanoma
    110305297 (Tp53)
   05219 Bladder cancer
    110305297 (Tp53)
   05215 Prostate cancer
    110305297 (Tp53)
   05213 Endometrial cancer
    110305297 (Tp53)
   05224 Breast cancer
    110305297 (Tp53)
   05222 Small cell lung cancer
    110305297 (Tp53)
   05223 Non-small cell lung cancer
    110305297 (Tp53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110305297 (Tp53)
   05014 Amyotrophic lateral sclerosis
    110305297 (Tp53)
   05016 Huntington disease
    110305297 (Tp53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110305297 (Tp53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110305297 (Tp53)
   05161 Hepatitis B
    110305297 (Tp53)
   05160 Hepatitis C
    110305297 (Tp53)
   05162 Measles
    110305297 (Tp53)
   05168 Herpes simplex virus 1 infection
    110305297 (Tp53)
   05163 Human cytomegalovirus infection
    110305297 (Tp53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110305297 (Tp53)
   05169 Epstein-Barr virus infection
    110305297 (Tp53)
   05165 Human papillomavirus infection
    110305297 (Tp53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110305297 (Tp53)
   01522 Endocrine resistance
    110305297 (Tp53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110305297 (Tp53)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110305297 (Tp53)
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110305297 (Tp53)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    110305297 (Tp53)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     110305297 (Tp53)
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110305297 (Tp53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 110305297
NCBI-ProteinID: XP_021032869
Ensembl: MGP_CAROLIEiJ_G0016574
UniProt: A0A6P5QV48
LinkDB
Position
11
AA seq 390 aa
MTAMEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHSMDDLLLSQDVEEFFEGPSEA
LQVSRAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVM
CTYSPPLNKLFCQLAKTCPVQLWVSSTPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCS
DGDGLAPPQHLIRVEGNLYAEYVEDRQTFRHSVVVPYEPPEVGSEYTTIHYKYMCNSSCM
GGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEIPCPELPPGS
AKRALPTCTSASPPQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDARATEESGDSR
AHSSYLKTKKGQSTSRHKKTMVKKVGPDSD
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgactgccatggaggagtcacagtcggatatcagcctcgagctccctctgagtcaggag
acattttcaggcttatggaaactacttcctccagaagatatcctgccatcacctcactcc
atggacgatctgttgctgtcccaggatgttgaggagttttttgaaggcccaagtgaagcc
ctccaagtgtcaagagctcctgcagcacaggaccctgtcaccgagacccctgggccagtg
gcccctgccccagccactccatggcccctgtcatcttttgtcccttctcaaaaaacttac
cagggcaactatggcttccacctgggcttcctgcagtctgggacagccaagtctgttatg
tgcacgtactctcctcccctcaataagctattctgccagctggcaaagacctgccctgtg
cagttgtgggtcagctccacacctccagctgggagccgtgtccgagccatggccatctac
aagaagtcacagcacatgacggaggtcgtgagacgctgcccccaccatgagcgctgctcc
gatggtgatggcctggctcctccccagcatcttatccgggtggaaggaaatttgtatgcc
gagtatgtggaagacaggcagacttttcgccacagcgtggtggtaccgtatgagccaccc
gaggtcggctctgagtataccaccatccactacaagtacatgtgtaacagctcctgcatg
gggggcatgaaccgccggcctatccttaccatcatcacactggaagactccagtggaaac
cttctgggacgggacagctttgaggttcgtgtttgtgcctgccctgggagagaccggcgt
acagaggaagaaaatttccgcaaaaaggaaatcccttgccctgaactgcccccagggagc
gcaaagagagcgctgcccacctgcacgagcgcctctcccccgcaaaagaaaaaaccactt
gatggagagtatttcaccctcaagatccgagggcgggaacgcttcgagatgttccgggag
ctgaatgaggccttagagttaaaggatgcccgtgctacagaggagtctggagacagcagg
gctcactccagctacctgaagaccaagaagggccagtctacttcccgccataaaaaaaca
atggtcaagaaagtggggcctgactcagactga

DBGET integrated database retrieval system