KEGG   Mus caroli (Ryukyu mouse): 110305303
Entry
110305303         CDS       T05910                                 

Gene name
Ncor1
Definition
(RefSeq) nuclear receptor corepressor 1 isoform X1
  KO
K04650  nuclear receptor co-repressor 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04919  Thyroid hormone signaling pathway
mcal05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110305303 (Ncor1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110305303 (Ncor1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110305303 (Ncor1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110305303 (Ncor1)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110305303 (Ncor1)
SSDB
Motif
Pfam: GPS2_interact Myb_DNA-binding Myb_DNA-bind_6
Other DBs
NCBI-GeneID: 110305303
NCBI-ProteinID: XP_021032878
Ensembl: MGP_CAROLIEiJ_G0016491
UniProt: A0A6P7RWA1
LinkDB
Position
11
AA seq 2517 aa
MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSTRHQQEFAVPDYRSSHIEVSQTSQLLQQQ
QQQQQQLRRRPSLLSEFHPGSDRPQERRTGYEQFHSGPSPADHDSLESKRPRLEPVSDAH
FQRVSAAVLPLVHSLPEGLRSSADAKKDSAFGGKHEAPSSPLAGQSCGDDQNASPSKLSK
EELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQI
IYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNH
ARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQER
FQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFI
NMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYY
YLTKKNENYKALVRRNYGKRRGRNQQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDDEE
KDEKEDSKETAKEKDRTEATAEEPEEREQATPRGRKTANSQGRRKGRITRSMTSEAAAAS
AAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKS
EAQCKNFYFNYKRRHNLDNLLQQHKQKVSRAVVASRKPREERDVSQCESVASTVSAQEDE
DIEASNEEENPEDSEGADNSSDTESAPSPSPVEAAKSSEDSSENAASRGNTEPVAELEAT
TDPAPCASPSSAVPTTKPAERESVEAQVTDSASAETAEPMDVDHEECGAEGSSVLDPPAP
TKADSVDPEMQVPENAASKGEGDAKERDLESTSEKTEARDEDVVVAEQIQRPEPQSDNDS
SATCSADEDVDGEPERQRVFPMDAKPSLLNPPGSILISSPIKPNPLDLPQLQHRAAVIPP
MVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQIDLECRSSTSPCSTSKS
PNREWEGKSVAYMPYAEVKRALEQEAQMHSTAARSASPCRLSPREVSKAASQPDMSAARY
SVPPVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGT
PGTYLSSHNQAYTQEASKPSVGSISLGLPRQQESTKAAPLTYIKQEEFSPRSQNSQPEGL
LVRAQHEGVVRGTAGAVQEGSITRGTPASKISVETISSLRGSITQGTPALPQAGIPTEAL
VKGPVSRMPIEESSPEKVREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEMS
LKRSYEAVEGSIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPR
ATAESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILSQ
ESRKTPDVVQGTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLPRGMLEIVP
ENIKVVERGKYEDVKAGEPVRARHTSVVSSGPSVLRSTLHEAPKAQLSPGLYDDSSARRT
PVSYQNTISRGSPMMNRTADVSSSKSTSHERKSTLTPTQRESIPAKSPVPGVDPVVSHSP
FEPHHRSSAAGEVYRSHLPTHLDPAMPFHRALDPAAAAYLLQRQLSPTPGYPSQYQLYAM
ENTRQTILNDYITSQQMQVNLRPDVARGLSPREQPLGLPYPATRGIIDLTNMPPTILVPH
AGGTSTPPMDRITYIPGTQITFPPRPYNAASLSPGHPTHLAAAASAEREREREREKERER
ERERERERITAAPADLYLRPGSEQPGRPGSHGYVRSPSPSVRTQESVLQQRPSVFQGTNG
TSVITPLDPTAQLRIMPLPSGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTK
ESKHEAARLEENLRSRSAAVSEQQQLEQKNLEVEKRSVQCVCTSSALPSGKPQPHASVVY
SEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSS
LSSHRYETASDAIEVISPASSPAPPQEKPQAYQPEMVKANQAENESTRQYEGPLHHYRSQ
QESPSPQQQPPLPPSSQSEGMGQVPRTHRLITLADHICQIITQDFARNQVPSQPSTSTFQ
TSPSALSSTPVRTKTSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGSRPGKSPERSHI
PSEPYEPISPPQGPAVHEKQDSMLLLSQRGVDPGEQRSDSRSPGSISYLPSFFTKLESTS
PMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGAVSSRSHSFADPASNLG
LEDIIRKALMGSFDDKVEDHGVVMPHPVGIMPGGASTSVVTSSETRRDEGEPSPHAGVCK
PKLINKSNSRKSKSPIPGQSYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQF
PYNPLTIRMLSSTPPTPIACTPSAITQAAPHQQNRIWEREPAPLLSAQYETLSDSDD
NT seq 7554 nt   +upstreamnt  +downstreamnt
atgtcaagttcaggttaccctcccaaccaaggagctttcagcacagagcaaagtcgttat
ccttcacattctgtccagtatacctttcccagtacccgacaccagcaggaatttgcagtt
cctgactaccgctcttctcatattgaagttagtcagacatcacagcttttacagcagcag
cagcagcagcagcagcagcttcgaagacgaccttccttgctttcagaatttcacccaggt
tctgacaggcctcaagaaagaagaactggatatgaacagtttcactcaggaccctcaccg
gcggatcatgattccttggagtccaagcgcccacgcctggagccggtttctgatgcccat
ttccagcgtgttagtgctgcggttttacctttagttcactcgctgccagaaggcttgagg
tcgtctgcagatgctaagaaggattcagcttttggaggcaaacatgaagctccatcctct
cctttggctgggcaatcatgtggagatgatcaaaatgcttcaccttcaaagctttcaaag
gaagagttaatacagagtatggaccgggtagaccgagagattgcaaaagtagagcagcag
atccttaaactgaaaaagaaacaacaacagctagaagaagaagcagctaagccccctgag
ccagagaagcctgtgtcccctcctcctgtggaacaaaaacaccgtagtattgtccaaatt
atttatgatgagaatcggaaaaaagcagaagaagctcataaaatatttgaaggtcttggc
ccaaaagttgaactgccactctataaccagccatcagataccaaggtgtaccatgagaac
atcaagacaaaccaggtgatgaggaaaaaactcattttattttttaaaagaagaaatcat
gcaagaaaacaaagggaacaaaaaatctgccagcgctatgatcagctcatggaagcgtgg
gagaaaaaagtggacagaatagaaaataatccccggaggaaagcaaaagaaagcaaaaca
agggaatactatgagaagcagtttccagaaattcgaaaacaaagagagcagcaagaacga
tttcagcgagttggtcagaggggagctggtctttcagccaccattgctaggagtgagcat
gagatttctgaaattattgatggtctttctgaacaggagaataatgagaagcaaatgcgt
cagctttctgtaattccacctatgatgtttgatgcagaacaaagaagggtcaaattcatc
aatatgaatgggctgatggaggacccaatgaaggtttataaagacagacagtttatgaat
gtttggactgaccatgaaaaggagatctttaaggacaagtttatccagcatccaaaaaac
tttggattaattgcatcctatttggaaaggaagagtgttcctgattgtgttttatattac
tatttaaccaagaaaaatgagaattataaggcccttgtgagaaggaattatggaaaacgc
agaggcagaaatcagcagcagattgcccgtccctcacaagaagaaaaagtagaagaaaaa
gaagaggataaagcagaaaaaacagagaaaaaggaagaagaaaagaaggatgatgaagaa
aaagatgagaaggaagactctaaagaaacagccaaggaaaaggacagaacagaagccaca
gcagaagaacctgaagaaagagagcaggccactccaagggggcggaagactgctaacagc
caagggcgccggaagggccggatcaccaggtccatgacaagtgaagctgcagctgccagt
gctgctgctgcagccactgaggagcccccgccacccctgccgccaccaccagagcccatt
tctacagaacctgttgagacttcaagatggacagaagaagaaatggaagttgctaaaaaa
ggcctggtagaacatggtcgtaactgggcagccattgctaaaatggtgggaactaaaagt
gaagcccagtgtaaaaacttctattttaactataaaagacggcataatcttgacaacctt
ttgcagcaacataaacagaaagtgagtagagcagtagtggcttcacggaaaccccgtgaa
gaacgagatgtatctcagtgtgaaagtgttgcttccactgtttctgcccaagaggatgaa
gatattgaagcctcaaatgaggaggaaaatccagaagatagtgaaggtgctgacaatagt
tctgacacagaaagtgctccttctccttcaccagttgaagctgccaagtccagtgaagac
agcagtgaaaatgctgcttctcgaggaaacaccgagcctgtggctgagcttgaggccacc
actgaccctgcaccctgtgcatctccctcttcagcagttccaaccacaaaaccagcagaa
agggaaagcgtggaggcccaggtgaccgacagtgccagtgccgagactgcagagccgatg
gatgtagaccacgaggagtgcggtgccgagggcagttctgttcttgatccaccagcccct
accaaagccgactccgtggacccagaaatgcaggtaccagaaaatgctgcgtctaaaggt
gaaggggatgccaaggaaagagacttggagagcaccagtgagaagacagaggctagagat
gaagacgtggtagtggctgaacagatccagaggcctgaaccacagtcagacaacgactcc
agtgccacttgcagtgcggatgaggatgtggatggagagccagaaaggcagagagtgttt
cccatggatgcaaagccttcattgttaaatcctcctggatccatcctaatctcatcccct
attaaaccaaacccactggatctgccacagcttcagcatcgagctgctgttattccacca
atggtttcttgcactccatgtaatataccaattggaacgcccgtaagtggctatgctctt
taccaacggcacattaaggccatgcatgagtcagcactcctggaggaacagcggcagagg
caagaacagatagacttggaatgcagaagctctacaagcccatgcagcacttctaagagt
ccaaacagggagtgggaaggaaaatcagtcgcctatatgccttatgctgaggtcaaacgt
gctctagaacaggaagcacagatgcacagtaccgcagcaaggtcagcctcaccgtgtagg
ctctctccaagagaagtcagtaaagccgcttcccagcctgatatgagtgcagcccgctat
agtgtccctccagtcctccaacctgctccgcatcaagtgataactaaccttcctgaaggg
gttcggcttccaacaacacgaccaaccaggccaccacctcccctcatcccatcgtctaaa
accacagtggcatcagaaaaaccatcctttataatgggagggtctatctcacagggaact
cctggcacttacttgtcttctcataatcaggcttatactcaagaagcatctaagccctcg
gtggggtctatctctctgggattgccacggcagcaggagtctaccaaagcagctcctttg
acctacatcaagcaggaagaattttctccacgaagccaaaactcacaacctgagggttta
ttggtcagagcgcagcatgaaggtgtggtcagaggcactgcaggggctgtccaagaagga
agtataactcggggaactccagccagcaaaatctcagtggagaccatttcatcattgcgg
ggctctattacccaggggaccccagctctgccccaggctggcataccaacagaggctttg
gtgaagggacctgtctccaggatgcctattgaagaaagcagtcctgagaaggtcagagag
gaagctgcatccaaaggccatgttatctatgaaggcaaaagtggacatatcttatcatat
gataatattaagaatgcccgagaagggactcggagtccaagaacagctcatgaaatgagt
ttaaaaagaagctatgaggcagtggaaggaagtataaagcaaggcatgtcgatgagggag
tctcctgtgtcagcacctttagagggtctgatatgccgagcattacccagggggagccct
cattctgacctcaaagagaggactgtgctgtctggttccataatgcagggcacaccaaga
gccacagctgaaagctttgaagacggccttaaataccccaaacagataaaaagggagagc
cctcccatccgagcatttgaaggtgccatcaccaaagggaaaccatacgatggcatcacc
accatcaaagaaatgggacgctccatccatgaaattccacggcaagacattctctctcag
gaaagccgaaaaactccagacgtggtccagggcacgaggccaataattgagggttccatt
tcccagggcacaccaataaaatttgacaacaactcaggtcaatcagctatcaaacacaat
gtgaagtccttaatcacagggcctagcaaactaccccgtggaatgctggaaattgtacca
gagaacataaaagtagtagaacggggaaaatatgaggatgtgaaagcaggcgagccagtg
cgagcccggcacacgtcagtggtgagctctggaccctccgttctcaggtctacacttcac
gaagctcccaaagcacagctgagcccgggactctacgatgacagcagtgctcgcaggact
cctgtgagttatcagaacaccatctccagaggctcccccatgatgaacagaactgctgat
gtttcttccagcaagtctaccagtcatgaaaggaaatcaactctgaccccaacccaaaga
gaaagtataccagccaagtctccagtgcccggagtggatcctgtcgtgagtcacagccca
tttgagcctcatcacaggagtagcgctgcaggagaggtttatcggagccacctacccacg
cacttggatccagccatgccctttcacagggctttggatcctgcagctgctgcttacctg
ttacagagacagctttcgccaaccccaggatacccaagtcagtaccagctctatgcaatg
gagaacacaaggcagacaatcctcaacgactacatcacctcacagcagatgcaggtgaat
ctgcgccctgatgtcgccaggggactgtccccacgagagcagccactggggctcccttat
ccagctacaagaggaatcattgacctgaccaatatgcctccaacaattttagtgcctcat
gcagggggaacaagcactcctcccatggacagaatcacgtatatccctggcacacagatt
actttccctcccaggccgtataatgctgcttctctgtctccaggacacccaacacacctt
gcagcagctgcaagtgctgagagggaacgagagcgggaaagggagaaggagcgtgaacgt
gagcgtgaacgcgagcgcgaaaggatcactgctgctcccgctgacctctacctgcgacca
ggttcagaacagccaggccgccctggcagccacggatatgttcgctccccttccccttca
gtaagaactcaggagagcgtcctgcagcagagacccagtgttttccagggcaccaatgga
accagtgtaatcacgcctttggaccccactgctcagctacgcatcatgccactgccttcg
gggggcccttccataagtcaaggcctgccagcctcccgctacaacactgctgcggatgcc
ctggctgctcttgtggatgctgcagcttctgcaccccagatggatgtttccaaaacaaaa
gagagtaagcatgaagctgccaggttagaagaaaatttgagaagcaggtcagcagcagtt
agtgaacagcagcagctagagcagaaaaacctggaggtggagaagagatctgttcagtgt
gtgtgcacttcttcagcccttccaagtggcaagccccagcctcatgcctcagtagtgtat
tctgaggctgggaaagataaagggcctcctccaaaatccagatatgaggaagagctaagg
acccgagggaagactaccattactgcagctaacttcatagacgtgatcatcacccggcaa
attgcctcggacaaggatgcgagggaacgtggctctcaaagttcagactcttctagtagc
ttgtcttctcacaggtatgaaacagctagtgatgctattgaggtgataagtcctgccagc
tcacctgcaccaccccaggaaaagccacaggcctatcagccagagatggttaaggcaaat
caagcagaaaatgagtccactcgacagtatgaaggaccactgcatcattatcggtcccag
caggaatcaccatctccacagcaacagccaccactgcccccatcttcccagtcagaggga
atgggacaggtgcccaggacccatcgactgatcacacttgctgaccacatctgtcaaatt
atcacacaagattttgctagaaatcaagttccctcgcagccttctacttctacattccaa
acttcaccatctgctttgtcatccacacctgtaagaactaaaacctcaagtcgctacagc
ccagaatcacagtctcagactgtcctgcatcccagaccaggtcctagagtctctccagaa
aatcttgtggataaatcccggggaagcaggcctggaaaatctccagagaggagtcatatc
ccatcagagccctatgagcccatctccccaccccaaggccctgctgtgcatgagaagcag
gacagcatgttgctcttgtcacagaggggagtggaccctggtgagcaaaggagtgattct
cgatcaccaggaagtataagctacttgccttcattcttcaccaagcttgaaagcacatca
cccatggttaaatcaaagaaacaggaaatttttcgtaagttgaactcttctggtggaggt
gactctgatatggcagctgctcagccaggaacagagatcttcaatctgccagcagtcacc
acatcaggtgcagtgagctcaagaagccattcttttgctgatcctgccagtaaccttggt
ctagaagacatcatcagaaaggctctcatgggaagttttgatgataaagttgaagatcat
ggtgttgtcatgccccatcctgtgggcattatgcctggtggtgccagcacctcagtggtg
acgagcagtgagacacggagagatgaaggggagccgtcacctcacgcaggagtatgcaaa
ccaaagctgatcaacaaatcaaacagcaggaagtctaaatctcctattcctgggcaaagc
tatttaggaactgaaaggccttcttctgtctcctctgtacattcagaaggtgattaccac
aggcagacaccaggatgggcatgggaagaccggccctcttcaacaggttctactcagttc
ccttacaaccctctgaccatacggatgctcagcagtacaccacctacaccgatcgcatgc
accccatctgccatcacccaagcagctccacatcaacagaaccgcatctgggagagggag
cctgccccgctcctctcagcgcagtatgagacactgtctgatagtgacgactga

DBGET integrated database retrieval system