KEGG   Mus caroli (Ryukyu mouse): 110305497
Entry
110305497         CDS       T05910                                 

Gene name
Rel
Definition
(RefSeq) proto-oncogene c-Rel
  KO
K09254  c-Rel proto-oncogene protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04014  Ras signaling pathway
mcal05202  Transcriptional misregulation in cancer
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110305497 (Rel)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110305497 (Rel)
   05203 Viral carcinogenesis
    110305497 (Rel)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110305497 (Rel)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    110305497 (Rel)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 110305497
NCBI-ProteinID: XP_021033157
Ensembl: MGP_CAROLIEiJ_G0016143
UniProt: A0A6P5QRR6
LinkDB
Position
11
AA seq 588 aa
MASSGYNPYVEIIEQPRQRGMRFRYKCEGRSAGSIPGERSTDNNRTYPSVQIMNYYGKGK
IRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGPERRPLFFQNLGIRCVKKKEVKEAII
LRISAGINPFNVPEQQLLDIEDCDLNVVRLCFQVFLPDEHGNFTTALPPIVSNPIYDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGVFSQADVHRQV
AIVFKTPPYCKAILEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIF
QKLLQDCGHFTEKPRTVPLGSTGEGRFIKKESNLFSHGTVLPDMPRSSGVPGQAEPFYSS
SGSISSGLPHHPPAIPSVAHQPTSWSPVTHSTSHPVSTNTLSSFSAGTLSSNSQGILPFL
EGPGVSDLSASNSCLYNTDDLTRMETPSMSPTDLYSISDVNMLSTRPLSVMAPSTDGMGD
TDNPRLVSINLENPSCNARLGPRDLRQLHQMSPASMSAGTSSSSVFVSQSDAFDRSNFSC
VDNGLMNEPGLSNDANNPTFVQSSQYSGINSLQSEQLSDSFTYGFFKI
NT seq 1767 nt   +upstreamnt  +downstreamnt
atggcctcgagtggatataatccatatgtagaaataattgaacagccaaggcagagggga
atgcggtttagatacaagtgtgaagggcgatcagcaggcagcattccaggggagcgcagc
acagacaacaaccggacatacccgtctgtccagattatgaactactatggaaaaggaaaa
ataagaattacattagtaacaaagaatgacccatataaacctcatcctcatgatttagtt
ggaaaagattgcagagatggatactatgaagcagaatttggaccagaacgcagacctctg
ttttttcaaaatttgggtattcggtgtgtaaagaaaaaggaagtgaaagaagctattatt
ttaaggattagtgcaggaatcaaccctttcaatgtccctgaacagcagctgctggacatt
gaagactgcgacctcaatgtggtgaggctgtgttttcaagttttccttcctgatgaacat
ggtaacttcacaactgctctgcctcccattgtttctaacccaatttatgacaaccgtgcc
ccaaatactgcagaattaaggatctgccgtgtgaacaagaactgtggaagtgtcagggga
ggagatgaaatatttctgctttgtgacaaagttcagaaagatgatatagaagttcgtttt
gtgttgaatgactgggaagccaaaggtgttttttcacaagctgatgtacaccgccaagta
gccatcgttttcaagactcctccatattgcaaagctatattggagcctgtgacagtgaaa
atgcagctgcggaggccttctgaccaggaagttagtgagtctatggatttcagatacctg
ccagatgaaaaagatgcatatggcaataaatcaaagaagcaaaaaacaactctgatcttt
cagaaactgctgcaagattgtggtcactttactgagaaaccaagaactgtccctctgggg
tcaactggagaaggaagattcatcaaaaaagaatcaaacttgttttctcatggtacagtt
ttaccagacatgcccaggtcttcaggagttccagggcaagctgaacccttctattcttca
tccgggtccatctcaagtggattgccacatcacccaccagccataccctcagtggcccat
cagcctacaagctggtcaccagtgactcactccacctcacacccagttagtacaaatacc
ctgagtagtttctcagcgggaacactttcctctaattcacaaggtatccttccattccta
gaagggcctggtgtgagcgacttgagtgcgtctaattcgtgcctttataatactgatgac
ctaactagaatggaaacgccatccatgtcaccaactgacttatacagtatctctgatgtc
aacatgctatctactcggcctctgagtgtgatggcacccagcactgatggcatgggggac
actgacaacccaagacttgtgagcatcaatctcgaaaacccctcatgtaatgccaggtta
ggcccaagagacctgaggcaactacatcagatgtctcctgccagtatgtcagcgggcacc
agctccagttctgtttttgtttcacagtcagatgcgtttgatagatcaaacttcagttgt
gtagataatggcctgatgaatgagcctggactatcaaatgatgcaaataatcctactttt
gttcagagcagccagtattcaggtattaactctctgcaaagtgagcagttgagtgattcc
ttcacatatggcttttttaaaatataa

DBGET integrated database retrieval system