KEGG   Mus caroli (Ryukyu mouse): 110305683
Entry
110305683         CDS       T05910                                 

Gene name
Slc9a3r1
Definition
(RefSeq) Na(+)/H(+) exchange regulatory cofactor NHE-RF1
  KO
K13365  sodium/hydrogen exchange regulatory cofactor NHE-RF1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04530  Tight junction
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110305683 (Slc9a3r1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    110305683 (Slc9a3r1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110305683 (Slc9a3r1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcal02000]
    110305683 (Slc9a3r1)
Transporters [BR:mcal02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   110305683 (Slc9a3r1)
SSDB
Motif
Pfam: EBP50_C PDZ PDZ_6 PDZ_2 Phasin
Other DBs
NCBI-GeneID: 110305683
NCBI-ProteinID: XP_021033408
Ensembl: MGP_CAROLIEiJ_G0017389
UniProt: A0A6P5QQP3
LinkDB
Position
11
AA seq 355 aa
MSADAAAGEPLPRLCCLEKGPNGYGFHLHGEKGKVGQFIRLVEPGSPAEKSGLLAGDRLV
EVNGENVEKETHQQVVSRIRAALNSVRLLVVDPETDERLKKLGVPIREELLRPQEKSEQA
EPPAAADTHEAGDQNEAEKSHLRELRPRLCTMKKGPNGYGFNLHSDKSKPGQFIRAVDPD
SPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIKGGGDEAKLLVVDKETDEFFKKCKVT
PSQEHLDGPLPEPFSNGDIQKESSRETLVEPASESPRPALARSASSDTSEELNSQDSPKR
QVSTEPSSTSSSSSDPILDLNISLAVAKERAHQKRSSKRAPQMDWSKKNELFSNL
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgagcgcggacgcagcggccggggagcctctgccccggctctgctgcctggagaagggt
ccaaacggctacggcttccacctgcacggggagaagggcaaggtgggccagtttatccgt
ctggtagaacctggctcgccggccgagaagtcggggttgctggccggagaccgattggtg
gaggtgaacggcgagaatgtggagaaggagacgcatcagcaggtggtgagccgcatccgc
gcggcgctgaactccgtgcgcctgctggtggtcgacccggagaccgacgagcgtctcaag
aagctgggcgtcccgatccgggaagagctgctgcgcccccaggagaagtccgaacaagcc
gagcctccagcggccgccgacactcatgaggctggggaccagaatgaggccgaaaagagc
cacttgcgcgagctccggccccggctctgcaccatgaagaaaggccccaatggctatggc
ttcaacctgcacagtgacaagtctaagccaggccagttcatccgagcagtggacccagac
tcaccagcggaggcgtctggactccgggcccaggaccgaattgtggaggtcaatggtgtc
tgcatggagggcaagcagcacggcgacgtggtgtccgccatcaagggtggaggtgatgag
gccaagctgctggtggtagacaaggaaacagatgagttcttcaagaagtgcaaagtgacc
ccatcccaggagcatctggatggccccttgcctgagcccttcagcaatggagacatacag
aaggagagcagccgtgaaaccctggtggagccagcttcagagagccccaggccagccctg
gcaagatctgcctccagcgataccagtgaggagctaaattcccaagacagccccaagaga
caagtttccacagagccctcatctacctcctcctcctcctctgaccccatcttggacctc
aacatctccttggctgtggctaaagagagggcccaccagaagcgcagtagcaagagggcc
ccgcagatggactggagcaagaaaaacgaactcttcagcaacctctga

DBGET integrated database retrieval system