KEGG   Mus caroli (Ryukyu mouse): 110305684
Entry
110305684         CDS       T05910                                 

Gene name
Birc5
Definition
(RefSeq) baculoviral IAP repeat-containing protein 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal04390  Hippo signaling pathway
mcal05161  Hepatitis B
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110305684 (Birc5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110305684 (Birc5)
   04215 Apoptosis - multiple species
    110305684 (Birc5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110305684 (Birc5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110305684 (Birc5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110305684 (Birc5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110305684 (Birc5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcal01002]
    110305684 (Birc5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110305684 (Birc5)
Peptidases and inhibitors [BR:mcal01002]
 Peptidase inhibitors
  Family I32: IAP family
   110305684 (Birc5)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     110305684 (Birc5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    110305684 (Birc5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 110305684
NCBI-ProteinID: XP_021033409
Ensembl: MGP_CAROLIEiJ_G0017473
UniProt: A0A6P5QSH9
LinkDB
Position
11
AA seq 142 aa
MGAPALPPTWQLYLKNYRIATFKNWPFLEXCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNK
QKEFEETAKTTRQSIEQLAALC
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggggctccggcgctgcccccgacctggcaactgtacctcaagaactaccgtatcgcc
accttcaagaactggcccttcctggagnactgcgcctgcaccccagagcggatggcggag
gctggcttcatccactgccctaccgagaacgagcctgacttggcccagtgttttttctgc
tttaaggaattggaaggctgggaacccgatgacaacccgatagaggaacatagaaagcac
tcccctggctgtgccttccttactgtcaagaagcagatggaagaactaaccgtcagtgaa
ttcttgaaactggacagacagagagccaagaacaaaattgctaaggagaccaacaacaag
caaaaagagtttgaagagactgcaaagactacccgccagtcaattgagcagctggctgcc
ttatgctga

DBGET integrated database retrieval system