KEGG   Mus caroli (Ryukyu mouse): 110305887
Entry
110305887         CDS       T05910                                 

Gene name
Flcn
Definition
(RefSeq) LOW QUALITY PROTEIN: folliculin
  KO
K09594  folliculin
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    110305887 (Flcn)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110305887 (Flcn)
SSDB
Motif
Pfam: Folliculin_C Folliculin
Other DBs
NCBI-GeneID: 110305887
NCBI-ProteinID: XP_021033703
Ensembl: MGP_CAROLIEiJ_G0016444
UniProt: A0A6P5QT65
LinkDB
Position
11
AA seq 580 aa
MNAIVALCHFCELHGPRTLFCTEVLHAPLPQGAGSGDSPDQVEQAEEEEGGIQMSSRVRA
HSPAEGASSESSSPGPKKSDMCEGCRSLAVGHPGYISHDKETSIKYVSHQHPNHPQLFSI
VRQACVRSLSCEVCPGREGPIFFGDEQHGFVFSHTFFIKDSLARGFQRWYSIIAIMMDRI
YLINSWPFLLGRIRGIISELQAKAFKVFEAEQFGCPQRAQRMNTAFTPFLHQRNGNAARS
LTSLTSDDNLWACLHTSFAWLLKACGSRLTEKLLEGAPTEDTLVQMEKLADLEEESESWD
NSEAEEEEKAPVTPEGAEGRELTSCPTESSFLSACGSWQPPKLTGFKSLRHMRQVLGAPS
FRMLAWHVLMGNQVIWKSRDVNLVHSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGL
SPPVPIPAHVLASGXVCETHAACCSERLPDLAQGCTRIQITDFRAKQYSAVPVRTAWACL
EPLEPCLLNCNISICVFQCLTGLWVXVFVFVFHSKVKVLFKFTKVDSRPKEDTQRLLSVL
GASEEDNVKLLKFWMTGLSKTYKSHLMSTVRSPTATESRS
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgaacgccatagtcgccctctgccacttctgcgagctccatggcccccgcacgctcttc
tgcacggaagttctacacgctcctctgccccagggggccggaagtggggacagtcctgac
caggttgagcaggctgaggaggaggagggtggcattcagatgagcagccgggtccgtgcc
cacagcccagccgagggtgccagcagtgagtccagcagcccggggcccaagaagtcggac
atgtgtgagggctgtcggtcacttgccgtagggcacccaggctatatcagtcatgataaa
gagacctctattaagtacgtcagtcaccagcaccccaaccacccgcagctcttcagcatc
gtccgccaggcctgtgtccggagcctgagctgtgaggtatgccctggtcgtgaaggcccc
atcttctttggtgatgagcagcatggctttgtgttcagccacaccttcttcatcaaagac
agcctggccagaggcttccagcgctggtacagcatcatcgccatcatgatggatcggatc
tacctcatcaactcctggcccttcctgctggggaggatccgtggcatcatcagtgagctc
caggccaaggccttcaaggtgtttgaggcagagcagtttggatgtccacagcgtgcccag
aggatgaacactgccttcacgcccttcctgcaccagaggaacggcaacgctgcccgctct
ctgacctccttgaccagtgatgacaacttgtgggcgtgtctgcacacttcctttgcctgg
ctcctgaaggcatgtggtagcaggctgacagaaaagctcttagagggtgctcccacagag
gacaccctggtccagatggagaagcttgctgacttggaggaagaatcagaaagttgggac
aattctgaggctgaagaggaggagaaagcccctgttacaccagagggtgctgaagggcga
gagctgaccagttgcccaacagagtcatcctttctctcagcctgtgggagctggcagccc
ccaaagcttaccggcttcaagtctcttcgacacatgagacaggtcttgggtgctccatcc
ttccgtatgttggcttggcatgtcctcatggggaatcaggtgatctggaaaagcagagat
gtgaacctggtccattcagcgtttgaagtcctccggaccatgctgcctgtgggctgtgtc
cgcatcatcccttacagcagccagtatgaggaggcctatcgctgcaacttcctggggctc
agccctcccgtgcctatccctgcccatgttctggcctcaggtnaagtgtgtgagacacac
gctgcctgctgctctgaaaggctcccggatctagcccaggggtgcacccggatccaaatc
acagactttagggcaaagcagtactctgcagtgccagtgaggacggcctgggcttgcctg
gagcccctggagccgtgccttctgaactgtaatataagtatttgtgttttccagtgcttg
actgggctgtgggtctgagtgtttgtctttgttttccacagcaaagtgaaagtcctgttt
aaattcaccaaggtagacagtcgccccaaggaggacacacagaggctcctaagtgtccta
ggcgcgtcagaggaggacaacgtcaaactgctgaagttctggatgacgggactgagcaaa
acctacaagtcccatctcatgtccaccgtccgaagccccacagctacagagtcacggagc
tga

DBGET integrated database retrieval system