KEGG   Mus caroli (Ryukyu mouse): 110306003
Entry
110306003         CDS       T05910                                 

Gene name
Il4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04151  PI3K-Akt signaling pathway
mcal04630  JAK-STAT signaling pathway
mcal04640  Hematopoietic cell lineage
mcal04657  IL-17 signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04660  T cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04672  Intestinal immune network for IgA production
mcal05140  Leishmaniasis
mcal05200  Pathways in cancer
mcal05310  Asthma
mcal05320  Autoimmune thyroid disease
mcal05321  Inflammatory bowel disease
mcal05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110306003 (Il4)
   04151 PI3K-Akt signaling pathway
    110306003 (Il4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110306003 (Il4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110306003 (Il4)
   04660 T cell receptor signaling pathway
    110306003 (Il4)
   04658 Th1 and Th2 cell differentiation
    110306003 (Il4)
   04659 Th17 cell differentiation
    110306003 (Il4)
   04657 IL-17 signaling pathway
    110306003 (Il4)
   04664 Fc epsilon RI signaling pathway
    110306003 (Il4)
   04672 Intestinal immune network for IgA production
    110306003 (Il4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110306003 (Il4)
  09163 Immune disease
   05310 Asthma
    110306003 (Il4)
   05320 Autoimmune thyroid disease
    110306003 (Il4)
   05321 Inflammatory bowel disease
    110306003 (Il4)
   05330 Allograft rejection
    110306003 (Il4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    110306003 (Il4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110306003 (Il4)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110306003 (Il4)
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Interleukins
   110306003 (Il4)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Haparin
  Cytokines
   110306003 (Il4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 110306003
NCBI-ProteinID: XP_021033853
Ensembl: MGP_CAROLIEiJ_G0016342
LinkDB
Position
11
AA seq 142 aa
MGLSPQLAVILLFFLECTGSHIHGCDDNHLIEIIGILNEVTGEGTPCTKMLVPDVLTATK
NTTESELICRASKVLRIFYLKHGKTPCLKKNSRVLTELQRLFRALGCLDSSISCTMNESK
STSLKDFLERLKSIMQMDYSQS
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggtctcagcccccagctagctgtcatcctgctcttctttcttgaatgtaccgggagc
catatccacggatgcgacgacaatcacttgatagaaatcatcggcattttgaatgaggtc
acaggagaagggacgccatgcaccaagatgcttgtgccagatgtccttacagcaacgaag
aacaccacagagagtgagctcatctgtagggcttccaaggtgcttcgcatattttattta
aaacatgggaaaactccgtgcttgaagaagaactctagagttctcaccgagctgcagaga
ctctttcgggccttgggatgcctggattcatcgataagctgcaccatgaatgagtccaag
tccacatcactgaaagacttcctggaaagactaaagagcatcatgcaaatggattactcg
cagtcctga

DBGET integrated database retrieval system