KEGG   Mus caroli (Ryukyu mouse): 110306329
Entry
110306329         CDS       T05910                                 

Definition
(RefSeq) interleukin-3-like
  KO
K04736  interleukin 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04630  JAK-STAT signaling pathway
mcal04640  Hematopoietic cell lineage
mcal04664  Fc epsilon RI signaling pathway
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05221  Acute myeloid leukemia
mcal05310  Asthma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110306329
   04151 PI3K-Akt signaling pathway
    110306329
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110306329
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110306329
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110306329
   04664 Fc epsilon RI signaling pathway
    110306329
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110306329
   05202 Transcriptional misregulation in cancer
    110306329
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110306329
  09163 Immune disease
   05310 Asthma
    110306329
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110306329
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110306329
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Interleukins
   110306329
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Haparin
  Cytokines
   110306329
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 110306329
NCBI-ProteinID: XP_021034156
Ensembl: MGP_CAROLIEiJ_G0016355
LinkDB
Position
11
AA seq 165 aa
MVLASSTTSIHSMLLLLLMLFHQGLQASISGPGTRRLTRTLNCSSIVKEIIGKLPEYEVE
TVHARALRDKTFRRVNLSKFLESQGKLDPKDKYVIKSNLQKLNCCLPASANDSALSGVFI
RDLDDFWKKLRFYMVHLNDLETVLTFRPPQPASGSVSPNRGTVEC
NT seq 498 nt   +upstreamnt  +downstreamnt
atggttcttgccagctctaccaccagcatccactccatgctgctcctgctcctgatgctc
ttccaccagggactccaagcttcaatcagtggcccgggtacccgccgtttaaccagaacg
ttgaattgcagctctattgtcaaggagattatagggaagctcccagaatatgaagtcgaa
actgttcatgcaagagccctgagggataagacctttcggagagtaaacctgtccaaattc
ctggaaagccaagggaaattggatcctaaggacaaatatgttatcaagtccaatcttcag
aaacttaactgttgcctgcctgcatctgcgaatgactctgcgctgtcaggggtcttcatt
cgagatctggatgacttttggaagaaactgagattctacatggtccaccttaacgatctg
gagacagtgctaacttttagaccacctcagcctgcatctggctccgtctctcctaaccgt
ggaaccgtggaatgttaa

DBGET integrated database retrieval system