KEGG   Mus caroli (Ryukyu mouse): 110306494
Entry
110306494         CDS       T05910                                 

Gene name
Adcy3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00230  Purine metabolism
mcal01100  Metabolic pathways
mcal01522  Endocrine resistance
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04114  Oocyte meiosis
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04713  Circadian entrainment
mcal04714  Thermogenesis
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04727  GABAergic synapse
mcal04740  Olfactory transduction
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04913  Ovarian steroidogenesis
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04921  Oxytocin signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04962  Vasopressin-regulated water reabsorption
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal04976  Bile secretion
mcal05032  Morphine addiction
mcal05163  Human cytomegalovirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110306494 (Adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110306494 (Adcy3)
   04371 Apelin signaling pathway
    110306494 (Adcy3)
   04020 Calcium signaling pathway
    110306494 (Adcy3)
   04072 Phospholipase D signaling pathway
    110306494 (Adcy3)
   04024 cAMP signaling pathway
    110306494 (Adcy3)
   04022 cGMP-PKG signaling pathway
    110306494 (Adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110306494 (Adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110306494 (Adcy3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110306494 (Adcy3)
   04062 Chemokine signaling pathway
    110306494 (Adcy3)
  09152 Endocrine system
   04911 Insulin secretion
    110306494 (Adcy3)
   04923 Regulation of lipolysis in adipocytes
    110306494 (Adcy3)
   04912 GnRH signaling pathway
    110306494 (Adcy3)
   04913 Ovarian steroidogenesis
    110306494 (Adcy3)
   04915 Estrogen signaling pathway
    110306494 (Adcy3)
   04914 Progesterone-mediated oocyte maturation
    110306494 (Adcy3)
   04921 Oxytocin signaling pathway
    110306494 (Adcy3)
   04926 Relaxin signaling pathway
    110306494 (Adcy3)
   04935 Growth hormone synthesis, secretion and action
    110306494 (Adcy3)
   04918 Thyroid hormone synthesis
    110306494 (Adcy3)
   04928 Parathyroid hormone synthesis, secretion and action
    110306494 (Adcy3)
   04916 Melanogenesis
    110306494 (Adcy3)
   04925 Aldosterone synthesis and secretion
    110306494 (Adcy3)
   04927 Cortisol synthesis and secretion
    110306494 (Adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110306494 (Adcy3)
   04270 Vascular smooth muscle contraction
    110306494 (Adcy3)
  09154 Digestive system
   04970 Salivary secretion
    110306494 (Adcy3)
   04971 Gastric acid secretion
    110306494 (Adcy3)
   04972 Pancreatic secretion
    110306494 (Adcy3)
   04976 Bile secretion
    110306494 (Adcy3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110306494 (Adcy3)
  09156 Nervous system
   04724 Glutamatergic synapse
    110306494 (Adcy3)
   04727 GABAergic synapse
    110306494 (Adcy3)
   04725 Cholinergic synapse
    110306494 (Adcy3)
   04723 Retrograde endocannabinoid signaling
    110306494 (Adcy3)
  09157 Sensory system
   04740 Olfactory transduction
    110306494 (Adcy3)
   04750 Inflammatory mediator regulation of TRP channels
    110306494 (Adcy3)
  09149 Aging
   04211 Longevity regulating pathway
    110306494 (Adcy3)
   04213 Longevity regulating pathway - multiple species
    110306494 (Adcy3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110306494 (Adcy3)
   04714 Thermogenesis
    110306494 (Adcy3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110306494 (Adcy3)
  09165 Substance dependence
   05032 Morphine addiction
    110306494 (Adcy3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110306494 (Adcy3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110306494 (Adcy3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110306494 (Adcy3)
   05163 Human cytomegalovirus infection
    110306494 (Adcy3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110306494 (Adcy3)
Enzymes [BR:mcal01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110306494 (Adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA NCE101 Peptidase_S49_N
Other DBs
NCBI-GeneID: 110306494
NCBI-ProteinID: XP_021034267
Ensembl: MGP_CAROLIEiJ_G0017580
LinkDB
Position
12
AA seq 1144 aa
MPRNQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLMVAGVGLVLDII
LFVLCKKGLLPDRVSRKVVPYLLWLLISAQIFSYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDELEGMQLLREILANVFLYLCAIIVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLDEKGIETYLIIASKPEVKKTAQNGLNGSAMPNGAPASSKPSSPALIETKEPNGSAPAS
GSTSEEAEEQEAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQ
VVKKRNTFLLTMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLFCTAMVEILIDPWLMTNY
VTFVVGEVLLLILTICSMAAIFPRSFPKKLVAFSSWIDRTRWARNTWAMLAIFILVMANV
VDMLSCLQYYMGPYNMTAGMELDGGCMENPKYYNYVAVLSLIATIMLVQVSHMVKLTLML
LVTGAVTAINLYAWCPVFDEYDHKRFQEKDTPMVALEKMQVLATPGLNGTDRLPLVPSKY
SMTVMMFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHV
ARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFD
SLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSSKEEKSDKERWQHLADLADFA
LAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVM
GNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDRPAAFPNGSSVTLPHQV
VDNP
NT seq 3435 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctcggatcccgagtactcggcagagtactcagccgagtac
tcggtcagcctgccctctgaccccgaccgcggggtcggccggacccatgaaatttctgtg
cggaactcggggtcctgcctgtgcctgcctcgctttatgcggctgaccttcgtgcctgag
tccttggagaacctctaccagacctacttcaaaaggcagcgccatgagaccctgctggtg
ctggtggtctttgcggccctctttgactgctacgtggtagtgatgtgcgcggtggtcttc
tccagcgacaagctggcgcccctcatggtggcaggcgtcggtctggtgttggacatcatc
cttttcgtgctctgtaaaaaggggctgctcccagaccgagtgagccgcaaagtggtaccc
tacctgctgtggctgctcatctcggcccagatcttctcctacctgggcctgaacttttca
cgcgcccacgcagccagtgacactgtgggttggcaggccttctttgtcttctccttcttc
ataacgctgcccctcagcctcagccccatcgtgatcatctctgtggtctcctgtgttgtg
cacacgcttgtcttgggggtcactgtggcccagcagcagcaggatgagctggaagggatg
cagctgctgagggagatcctggccaacgtcttcctctacctgtgtgctatcatcgtgggc
atcatgtcctactacatggcagatcgcaagcatcgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaatctggaggagcagagccagcagcaggaaaaccttatgctt
tccatcctgcccaagcacgtggctgacgagatgctgaaggacatgaagaaggacgagagt
cagaaggaccagcagcagttcaataccatgtacatgtaccggcacgagaatgtcagcatc
ctgtttgcagatattgtgggctttacccagctgtcctctgcttgcagtgcccaggagctc
gtgaagttactcaacgagctcttcgcccgctttgacaagctggcggccaaataccaccag
ctgaggatcaagatcctaggcgactgttactactgcatctgcggcctgcctgactaccgg
gaggaccacgccgtgtgctccatccttatggggcttgccatggtagaggccatctcgtac
gtgcgggagaagaccaagactggagtggacatgcgtgtgggagtgcacacaggcactgtc
ctaggtggtgtcctgggccagaagcgctggcagtatgatgtatggtctactgatgtcacc
gtggcaaacaagatggaggctggtggcatcccagggcgcgtgcacatttctcagagcacc
atggactgtctgaagggggagtttgatgtggagcctggtgatgggggcagtcgctgcgac
tacctagatgagaagggcatcgaaacctacctcatcattgcctccaagccagaggtgaag
aaaacagcccaaaatggcctcaacggctcggccatgccaaacggagcgccggcatcctcc
aaacccagctcccctgccctcatcgagaccaaggagcccaatggaagtgcccctgccagc
ggctccacatcagaggaggctgaagaacaggaggcccaggctgacaacccctcgttcccc
aacccccgccgcaggctgcgcctccaggacctggcggaccgtgtggtggacgcctctgag
gatgagcacgaactgaaccagctgcttaacgaggccctgctggagcgggagtccgcccag
gtggtaaagaagagaaacacattcctcctgaccatgaggttcatggacccagagatggaa
acacgctactcggtggagaaggagaagcagagcggggctgccttcagttgctcctgtgtg
gtcctcttctgcacagccatggtggagatactcatcgacccctggctgatgacaaactat
gtgacctttgtggttggggaggttctgctcctgatcctgaccatctgctccatggctgcc
atctttcccaggtcatttcccaagaagctcgtggccttctcatcttggattgaccggacc
cgctgggcacggaacacctgggccatgttagccatcttcattctggttatggccaatgtt
gtggacatgcttagctgtctccagtactacatgggaccttacaacatgacagctgggatg
gagctggacggcggctgcatggagaaccccaagtactacaactatgtagctgtgctgtcg
ctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctgacgctcatgctg
ctcgtcacaggcgccgtgactgccatcaacctgtacgcctggtgtcctgtctttgatgaa
tacgaccacaagcgctttcaggaaaaggacactcccatggtggccttagagaagatgcag
gtacttgccacccctgggctcaatggcactgacaggctgcccctggtgccttccaagtac
tccatgactgtgatgatgttcgtcatgatgctgagcttttactacttctcgcgccacgtg
gaaaaactggcccgaacactgttcttgtggaagattgaggtccatgaccagaaagaacgt
gtctacgaaatgcgccgatggaatgaggccttggtcaccaacatgttgcctgagcatgtt
gcacgccattttctggggtccaagaagagagatgaggagctgtacagccagtcttatgac
gagattggagtcatgtttgcctccttgcccaactttgccgacttctacactgaggagagc
atcaacaacggtggcatcgagtgtctacgcttcctcaatgagatcatctctgattttgac
tctctcctggacaatcccaaattccgggtcatcaccaagatcaaaactattggcagcacc
tatatggcagcttcaggagtcacaccagatgtcaacaccaatggctttacaagctccagc
aaggaggagaagtcagacaaggagcgttggcagcacctggctgacctggccgactttgca
ttagccatgaaggacacgctcacaaacatcaacaaccagtcattcaacaacttcatgttg
cgcataggcatgaacaaaggaggggttctggctggcgtcattggagcccggaaaccacac
tatgacatctggggcaatacggtcaatgtggccagcaggatggaatccacaggagtcatg
ggcaacatccaggtggtggaagagacgcaggtcatccttcgagagtatggcttccgcttt
gtgaggcgaggtcccatctttgtgaaaggcaaaggggagcttctgacctttttcttgaag
gggcgggacaggccagctgccttccccaatggctcctctgttaccctgccccaccaagtg
gtggacaacccctga

DBGET integrated database retrieval system