KEGG   Mus caroli (Ryukyu mouse): 110306510
Entry
110306510         CDS       T05910                                 

Gene name
Ncoa1
Definition
(RefSeq) nuclear receptor coactivator 1 isoform X1
  KO
K09101  nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04915  Estrogen signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal05200  Pathways in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110306510 (Ncoa1)
   04919 Thyroid hormone signaling pathway
    110306510 (Ncoa1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110306510 (Ncoa1)
  09162 Cancer: specific types
   05224 Breast cancer
    110306510 (Ncoa1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110306510 (Ncoa1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     110306510 (Ncoa1)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    110306510 (Ncoa1)
SSDB
Motif
Pfam: PAS_11 DUF1518 NCOA_u2 SRC-1 Nuc_rec_co-act PAS PAS_3 DUF4927 PAS_9 HLH PAS_4 PAS_12
Other DBs
NCBI-GeneID: 110306510
NCBI-ProteinID: XP_021034292
Ensembl: MGP_CAROLIEiJ_G0017583
UniProt: A0A6P7RRK7
LinkDB
Position
12
AA seq 1447 aa
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPEDPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDSNSGMSIPRINPSVNPGISPAHGVTRSSTLPPSNNNMVSARVNR
QQSSDLNSSSSHSNSSNSQGNFGCSPGNQIVANVALNQGQAGSQSSNPSLNLSTSPMEGT
GISLSQFMSPRRQANSGLATRARMSNNSFPPNIPALSSPVGITSGACSNNNRSYSNIPVT
SLQGMNEGPNNSVGFSGGSPVLRQMSSQNSPSRLSMQPAKAESKDSKEIASILNEMIQSD
NSDNSANEGKPLDSGLLHNNDRLSEGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKD
VLSCTGTSSSASSNPSGGTCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPEKKDSVS
ASTAVSVSGQSQGSASIKLELDAAKKKESKDHQLLRYLLDKDEKDLRSTPNLCLDDVKVK
VEKKEQMDPCNTNPTAMTKPAPEEVKLESQSQFTADLDQFDQLLPTLEKAAQLPSLCETD
RMDGAVTGVNIKSEILPASLQPTTARSAPRLNRLPELELEAIDNQFGQPGAGDQIPWANN
TLTTINQNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRA
LGIDKLVQGGGLDVLSERFPPQQATPPLMMEDRPTLYSQPYSSPSPTAGLSGPFQGMVRQ
KPSLGTMPVQVTPPRGTFSPNMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLMHQNRQ
AILNQFAANAPVGMNMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQIIQQQRAML
MRHQSFGNNIPPSSGLPVQMGTPRLPQGAPQQFPYPPNYGANPGTPPASTSPFSQLAANP
EASLATRSSMVNRGMAGNMGGQFGAGISPQMQQNVFQYPGPGLVPQGEATFAPSLSPGSS
MVPMPVPPPQSSLIQQTPPTSGYQSPDMKAWQQGTMGNNNVFSQAVQSQPAPAQPGVYNN
MSITVSMAGGNANIQNMNPMMGQMQMSSLQMPGMNTVCSEQMNDPALRHTGLYCNQLSST
DLLKTDADGNQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSL
LQQLLTE
NT seq 4344 nt   +upstreamnt  +downstreamnt
atgagtggccttggggacagttcctcagaccctgcaaacccagactctcataagagaaaa
ggatcgccatgtgacacgctggcatcaagtaccgagaagaggcgcagggagcaagaaaat
aagtatttagaagaactagctgagctgctgtctgccaacatcagtgacattgacagcttg
agtgtaaaaccagataaatgcaagattttgaagaagacagtagatcagatacagctaatg
aagagaatggaacaagagaaatccacgactgatgatgatgtgcagaagtccgacatctcc
tcgagcagccaaggagtgatagagaaggagtcactgggccctcttcttctggaggctttg
gatggatttttctttgttgtgaactgtgaaggaagaattgtatttgtatcagaaaatgtg
accagctacttgggttacaatcaggaagaattaatgaataccagcgtctacagcatactg
catgtgggagatcatgcagaatttgtcaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaagaggcaacacgccgaaatagccatacatttaactgcaggatgcta
attcaccctccagaggacccaggtactgagaaccaagaagcttgccagcgctatgaagta
atgcagtgtttcacagtgtcacagccaaaatccatccaagaagatggggaagatttccag
tcatgtctgatttgtattgctcgacgattacctcggcctccagccattacaggtgtagaa
tcctttatgaccaagcaagatactacaggcaaaatcatctctattgacactagctccctg
agagctgctggcaggactggctgggaagacctagtaaggaagtgcatctatgctttcttc
caacctcagggcagagagccatcttacgcacggcagctgtttcaagaagtgatgactcgt
ggcactgcctccagcccatcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtcctgacatgcagcctttcatcatggga
attcatatcatcgacagggagcacagtgggctttctcctcaagatgacagtaattctgga
atgtcaattccccgaataaatccctcagtcaatcctggtatctctccagcccatggagtg
acccgttcatccacgttgccaccatccaacaacaacatggtctctgccagagtaaaccgc
caacagagctcagacctcaacagcagcagcagccatagtaactctagcaacagccaaggg
aactttggatgttcacctggaaatcagattgtagccaacgttgccttaaaccaggggcag
gcaggttcccagagcagcaatccctctttaaacctcagtacttctcctatggaaggtaca
ggaatttccctctcacagttcatgtctccgaggagacaagctaattctggcttggcaaca
agggccaggatgtcaaacaattcatttcctccaaatattccagcattaagctccccagtt
ggcattactagtggtgcctgtagtaataataaccgatcctattcaaatatcccagtaaca
tctttacaaggtatgaatgaaggacccaataactctgttggcttctctggtgggtctcca
gtccttcggcagatgagctcacagaattcacctagcagattgagtatgcaaccagcaaag
gctgagtccaaagacagcaaagagattgcatccattttaaatgaaatgattcagtccgac
aacagcgacaacagcgctaacgaaggcaagcctctggactcaggacttctgcacaataat
gacagactctcagaaggagacagtaaatactctcaaactagtcacaagctagtacagctg
ttgactacaactgcagagcagcagttacggcatgccgacatagacacaagctgcaaagat
gtactgtcttgcactggtacttccagctctgcctcctctaacccctcaggaggtacttgt
ccctcttcccacagctctctgactgagcggcataaaattctgcaccggcttttacaggag
ggcagtccctcagacatcaccactttgtctgtggaacccgagaagaaggacagtgtgtca
gcatctactgctgtgtcagtgtctggacaatcccaggggagtgccagcataaaactagaa
ctggatgctgcaaagaaaaaagagtcaaaagaccatcagctcctacgctaccttttagac
aaagatgagaaagatttaaggtccactccaaacctgtgcctggatgacgtaaaggtcaaa
gtggagaaaaaagaacagatggatccttgtaacacaaacccaaccgcaatgaccaaacct
gctcctgaggaagtgaaactggagtcccagagccagtttacagctgaccttgaccagttt
gatcagttattgcccacactggagaaggcagcacagttgccgagcttgtgcgagacagac
aggatggatggtgcggtcaccggtgtcaacatcaagtcagagatcctgccagcttcactt
cagcccaccactgccagatctgctcccaggctgaacagactgcctgaactagaattagaa
gcaatcgataaccagtttggacaaccaggagcgggggatcaaattccatgggcaaataat
actttgacaacgataaatcagaataaaccagaagaccagtgtattagctcacagctggat
gagctgctctgcccaccaacaacagtagaaggaagaaacgatgagaaggctcttctggaa
cagctggtgtctttcctcagtggcaaagatgaaacggagctggccgagctcgaccgcgca
ctggggatcgacaagctcgtccagggaggtggattagatgtattatctgagagatttcca
ccacagcaagcaacaccacctttgatgatggaagacagacccaccctctattcccagcca
tactcatctccttctcccaccgctggtctctctggccctttccaaggcatggtacggcag
aagccttcactggggactatgccggttcaagtaacacctcctcgaggaaccttttcaccc
aacatgggcatgcagccccggcagactctcaatagacctccagctgcacccaaccagctt
cggctgcagctgcagcagcggctacaggggcagcagcagttgatgcaccaaaaccggcaa
gccatcttgaaccagtttgcagcaaatgctcctgttggcatgaacatgaggtcaggcatg
cagcagcagatcacacctcagccacccttgaatgctcagatgttggcacagcgccagcgg
gagttgtacagtcagcagcatcgacagaggcaaattatacagcagcagagagccatgctc
atgaggcaccaaagttttgggaacaacatccctccttcatctggactcccagttcaaatg
gggaccccccgtcttcctcagggtgctccccagcagttcccctacccaccaaactatggc
gcaaacccaggaaccccacctgcctccaccagccctttctctcaactggcagcaaaccct
gaggcctccttggccacccgcagcagcatggtgaacagaggcatggcagggaacatggga
ggacagtttggcgctggcatcagtcctcagatgcagcagaatgtcttccaatatccagga
ccaggactagttccccaaggtgaggccacctttgccccatctctaagccctgggagctcc
atggtgccgatgccagtccctcctcctcaaagctctctgatccagcaaactccacctact
tctgggtaccagtcaccagacatgaaggcctggcagcaaggaacaatgggaaacaacaat
gtgttcagtcaagctgtccagagccagcctgcacctgcacagccaggagtgtacaacaac
atgagcatcaccgtgtccatggcaggtggaaacgcaaacattcagaacatgaatccaatg
atgggccagatgcagatgagctctctgcagatgccagggatgaatactgtgtgctctgag
cagatgaatgatccagcactgagacacacaggcctctactgcaaccagctctcatccact
gaccttctcaaaacagacgcagatggaaaccagcaggtgcagcaggttcaggtgttcgct
gacgtccagtgtacagtcaatctggtaggcggggacccttacctgaaccagcctggtcca
ctgggaactcaaaagcccacgtcaggaccacagaccccccaggcccagcagaagagcctc
cttcagcagctactgactgaataa

KEGG   Mus caroli (Ryukyu mouse): 110311955
Entry
110311955         CDS       T05910                                 

Gene name
Ncoa3
Definition
(RefSeq) nuclear receptor coactivator 3 isoform X1
  KO
K11256  nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04915  Estrogen signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal05200  Pathways in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110311955 (Ncoa3)
   04919 Thyroid hormone signaling pathway
    110311955 (Ncoa3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110311955 (Ncoa3)
  09162 Cancer: specific types
   05224 Breast cancer
    110311955 (Ncoa3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110311955 (Ncoa3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110311955 (Ncoa3)
Enzymes [BR:mcal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     110311955 (Ncoa3)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    110311955 (Ncoa3)
SSDB
Motif
Pfam: NCOA_u2 SRC-1 DUF4927 PAS_11 Nuc_rec_co-act DUF1518 PAS PAS_3 PAS_9 Spt20 HLH PAS_4 PAS_2
Other DBs
NCBI-GeneID: 110311955
NCBI-ProteinID: XP_021041194
Ensembl: MGP_CAROLIEiJ_G0024694
UniProt: A0A6P5R8D9
LinkDB
Position
2
AA seq 1399 aa
MSGLGESSLDPLAAESRKRKLPCDAPGQGLVYSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKTISSDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYSILHEQDRKDFLKHLPKSTVN
GVSWTNENQRQKSHTFNCRMLMKTHDILEDVNASPETRQRYETMQCFALSQPRAMLEEGE
DLQCCMICVARRVTAPFPSSPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDTIRRCIQR
FFSLNDGQSWSQKRHYQEAYVHGHAETPVYRFSLADGTIVSAQTKSKLFRNPVTNDRHGF
VSTHFLQREQNGYRPNPNPVGQGIRPPTAGCGVSMSPNQNVQMMGSRTYGVPDPSNTGQM
GGARYGASSSVASLTPGQSLQSPSSYQNSSYGLSMSSPPHGSPGLGPNQQNIMISPRNRG
SPKMASHQFSPAAGAHSPMGPSGNTGSHSFSSSSLSALQAISEGVGTSLLSTLSSPGPKL
DNSPNMNISQPSKVSGQDSKSPLGLYCEQNPVESSVCQSNSRDHPSDKESKESSAEVSET
PRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDPNCKDSSVSVTSPSGVSSSTSGTVS
STSNVHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTASCGEGTTRQEQLSP
KKKENNALLRYLLDRDDPSDVLAKELQPQADSGDSKLSQCSCSTNPSSGQEKDPKIKTET
SEEVSGDLDNLDAILGDLTSSDFYNNPTNGSHPGAKQQMFAGPSSLGLRSPQPVQSVRPP
YNRAASLDSPVSVGSGPPVKNVSAFPGLPKQPILAGNPRMMDSQENYGANMGPSRNVPVH
PASSSGDWGLANSRASRMEPLASSPLGRPGADYSAALPRPAMGGSVPTLPLRSNRLPGTR
PTLQQQQQQQQQQQQQQQQQQQQQQQQMLQMRTGEIPMGMGVNPYSPAVPSNQPGSWPEG
MLSMEQGPHGSQNRPLLRNSLDDLLGPPSNAEGQSDERALLDQLHTLLSNTDATGLEEID
RALGIPELVNQGQALESKQDVFQGQEAAVMMDQKAALYGQTYPAQGPPLQGGFNLQGQSP
SFNSMMGQISQQGSFPLQGMHPRAGLVRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEM
KMENPAGTAVMRPMMPQQAFFNAQMAAQQKRELMSHHLQQQRMAMMMSQPQPQAFSPPPN
VTASPSMDGVLAGSAMPQAPPQQFPYPANYGMGQPPEPAFGRGSSPPSAMMSSRMGPSQN
AMVQHPQPAPMYQPSDMKGWPTGSLARNGSFPQQQFAPQGNPAAYNMVHMNSSGGHLGQM
AMTPMPMSGMPMGPDQKYC
NT seq 4200 nt   +upstreamnt  +downstreamnt
atgagtggactaggcgaaagctctttggatccgctggccgctgagtctcggaaacgcaaa
ctgccctgcgatgccccaggacaggggcttgtctacagtggtgagaagtggcgacgggag
caggagagcaagtacatagaggagctggcagagctcatctctgcaaatctcagcgacatt
gacaacttcaatgtcaagccagataaatgtgccatcctaaaggagacagtgagacagata
cggcaaataaaagaacaaggaaaaactatttccagtgatgatgatgttcaaaaagctgat
gtgtcttctacagggcagggagtcattgataaagactctttaggaccgcttttactacag
gcactggatggtttcctgtttgtggtgaatcgagatggaaacattgtatttgtgtcagaa
aatgtcacacagtatctgcagtacaagcaggaggacctggttaacacaagtgtctacagc
atcttacatgagcaagaccggaaggatttccttaaacacttaccaaaatctacagttaat
ggagtttcttggactaatgagaaccagagacaaaaaagccatacgtttaattgtcgtatg
ttgatgaaaacacacgacattttggaagacgtgaatgccagtcccgaaacacgccagaga
tatgaaacaatgcagtgctttgccctgtctcagcctcgcgctatgctggaagaaggagaa
gacttgcagtgctgtatgatctgcgtggctcgccgcgtgactgcgccattcccatccagt
cctgagagctttattaccagacatgacctttccggaaaggttgtcaatatagatacaaac
tcacttagatcttccatgaggcctggctttgaagacacaatccgaagatgtatccagagg
ttcttcagtctgaatgatgggcagtcatggtcccagaagcgtcactatcaagaagcttac
gttcatggccatgcagagacccctgtgtatcgtttctccttggctgatggaactattgtg
agtgcgcagacaaaaagcaaactcttccgcaatcctgtaacgaatgatcgtcacggcttc
gtctcgacccactttcttcagagagaacagaatggatacagaccaaacccaaatcccgta
ggacaaggcatccgacctcctacagcagggtgtggcgtgagcatgtctccaaatcagaat
gtacagatgatgggcagccggacctatggggtgccagaccctagcaacacagggcagatg
ggtggagctaggtacggggcttctagtagcgtagcctcactgacgccaggacaaagccta
cagtcgccatcttcctatcagaacagcagctatgggctcagcatgagcagccccccccat
ggcagtcccggtctcggccccaaccagcagaacatcatgatttctccgcggaatcgtggg
agcccaaagatggcctcccaccagttctctcctgctgcaggtgcacactcacccatggga
ccttccggcaacacagggagccacagcttttccagcagctccctcagtgccttgcaagcc
atcagtgaaggcgtggggacctctcttttatctactctgtcctcaccaggccccaaactg
gataattctcccaatatgaatataagccagccaagtaaagtgagtggtcaggactctaag
agccccctaggcttatactgtgaacagaacccagtggagagttcggtgtgtcagtcaaac
agcagagatcacccaagtgacaaagaaagcaaggagagcagtgcggaggtgtcagagaca
cccaggggacccctagaaagcaaaggccacaagaaactactgcagttactcacatgctcc
tccgacgaccgaggccattcctccttgaccaactctcccctggatccaaactgcaaagac
tcttctgttagtgtcaccagcccctctggagtgtcctcctcaacatcagggacagtgtct
tccacctccaatgtgcatgggtctctgttgcaagagaaacaccggattttgcacaagttg
ctgcagaatggcaactccccagcggaggtcgccaagatcactgcagaggccactgggaag
gacactagcagcactgcttcctgtggagaggggacaaccaggcaggagcagctgagtcct
aagaagaaggagaataatgccctgcttagatacctgctggacagggatgaccccagtgat
gtgcttgccaaagagctgcagccccaggctgacagtggggacagtaaactgagtcagtgc
agctgctccaccaatcccagctccggccaagagaaagaccccaaaattaagaccgagacg
agcgaggaggtatcgggagacctggataatctagatgccattcttggagatttgactagt
tctgacttctacaacaatcctacaaatggcagtcacccaggggccaaacagcagatgttt
gcaggaccaagttctctgggtttgcgaagtccacagcctgtgcagtctgttcgtcctccg
tataaccgagcggcttctctggatagccctgtgtctgttggctcaggtccgccagtgaag
aatgtcagtgctttccctgggttaccaaaacagcccatactggctgggaatccaagaatg
atggatagtcaggagaattatggtgccaatatgggaccaagcagaaatgttcctgtgcat
ccggcttcctcctccggagactggggcttagctaactcaagggccagcagaatggagcct
ctggcatcaagtcccctgggaagacctggagcagattacagtgccgctttacccagacct
gccatggggggctctgtgcctaccttgccacttcgttctaatcgactgccaggcacaaga
ccaacgttgcagcaacagcagcagcagcaacaacaacagcagcagcaacagcagcagcaa
cagcagcagcagcagcagcagatgcttcaaatgagaactggtgagattcccatgggaatg
ggagtcaatccctatagcccagcagtgccgtctaaccaaccaggttcctggccagagggc
atgctatctatggaacaaggtcctcatgggtctcaaaataggcctcttcttagaaactct
ctggatgatctgcttgggccaccttctaacgcagagggccagagtgacgagagagctctg
ctggaccagctgcacacactcctgagcaacacagatgccacaggtctggaggagatcgac
agggccttggggattcctgagctcgtgaatcagggacaagctttggagtccaaacaggat
gttttccaaggccaagaagcagcagtgatgatggatcagaaggctgcattatatggacag
acgtacccagctcagggtcctccccttcaaggaggctttaaccttcagggacagtcacca
tcgtttaactctatgatgggtcagattagccagcaaggcagctttcctctgcaaggcatg
catcctagagccggcctcgtgagaccaaggaccaacaccccaaagcagctgagaatgcag
cttcagcagaggctgcagggccagcagtttttaaatcagagccggcaggcacttgaaatg
aaaatggagaaccccgcgggcactgctgtgatgaggcccatgatgccccagcaggctttc
tttaatgcccaaatggctgcccagcagaaacgagagctgatgagccatcacctgcagcag
cagaggatggcgatgatgatgtcacagccacagcctcaggccttcagcccacctcccaac
gtcaccgcctcccccagcatggatggggttttggcaggttcagcaatgccgcaagcccct
ccacaacagtttccatatccagcaaattacggaatgggacaaccaccagagccagccttt
ggtcgaggctcgagtcctcccagtgcaatgatgtcatcaagaatggggccttcccagaat
gccatggtgcagcatcctcagcccgcacccatgtatcagccttcagatatgaaggggtgg
ccgacagggagcctggccaggaacggctccttcccccagcagcagtttgctccccagggg
aaccctgcagcctacaacatggtgcacatgaacagcagcggtgggcacttgggacagatg
gccatgacccccatgcccatgtctggcatgcccatgggccccgatcagaaatactgctga

DBGET integrated database retrieval system