KEGG   Mus caroli (Ryukyu mouse): 110306746
Entry
110306746         CDS       T05910                                 

Gene name
Hif1a
Definition
(RefSeq) hypoxia-inducible factor 1-alpha isoform X1
  KO
K08268  hypoxia-inducible factor 1 alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04066  HIF-1 signaling pathway
mcal04137  Mitophagy - animal
mcal04140  Autophagy - animal
mcal04659  Th17 cell differentiation
mcal04919  Thyroid hormone signaling pathway
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05211  Renal cell carcinoma
mcal05230  Central carbon metabolism in cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    110306746 (Hif1a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110306746 (Hif1a)
   04137 Mitophagy - animal
    110306746 (Hif1a)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110306746 (Hif1a)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110306746 (Hif1a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110306746 (Hif1a)
   05205 Proteoglycans in cancer
    110306746 (Hif1a)
   05230 Central carbon metabolism in cancer
    110306746 (Hif1a)
   05231 Choline metabolism in cancer
    110306746 (Hif1a)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110306746 (Hif1a)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110306746 (Hif1a)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    110306746 (Hif1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110306746 (Hif1a)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    110306746 (Hif1a)
SSDB
Motif
Pfam: PAS_3 HIF-1a_CTAD PAS_11 HIF-1 PAS PAS_9 PAS_4 DDRGK HLH
Other DBs
NCBI-GeneID: 110306746
NCBI-ProteinID: XP_021034481
Ensembl: MGP_CAROLIEiJ_G0017848
UniProt: A0A6P5QYP1
LinkDB
Position
12
AA seq 830 aa
MEGAGGENEKKNRMSSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASV
MRLTISYLRVRKLLDAGDLDIEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKY
MGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGPVRKGKEQNTQRSFFLRMKCTLTSRG
RTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDS
KTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQ
VTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTES
VLKPVESSDMKMTQLFTKVESEDTSCLFDKLKKEPDALTLLAPAAGDTIISLDFGSDGQC
LDTETEDQQLEDVPLYNDVMFPSSNEKLNINLAMSPLPASETPKPLRSSADPALNQEVAL
KLESSPESLGLSFTMPQIQDRPASPSDGSTRQSSPEPNSPSEYCFDVDSDMVNVFKLELV
EKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESNSPSPPSMSTV
TGFQQTQLQKPTITATATTTATTATTDESKTETKDNKEDIKILIASPSSTQVPQETTTTK
ASAYSGTHSRTASPDRAGKRVIEQTDKAHPRSLNLSVTLNQRNTVPEEELNPKTIASQNA
QRKRKMEHDGSLFQAAGIGTLLQQPGDCAPAMSLSWKRVKGFISSEQNGTEQKTIILIPS
DLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
NT seq 2493 nt   +upstreamnt  +downstreamnt
atggagggcgccggcggcgagaacgagaagaaaaataggatgagttctgaacgtcgaaaa
gaaaagtctagagatgcagcaagatctcggcgaagcaaagagtctgaagttttttatgag
cttgctcatcagttgccacttccccacaatgtgagctcacatcttgataaagcttctgtt
atgaggctcaccatcagttatttacgtgtgagaaagcttctggatgccggtgatctagac
attgaagatgaaatgaaagcacagatgaactgcttttatctgaaagccctggatggcttt
gtaatggtgctaacagatgacggtgacatgatttacatttctgataacgtgaacaaatac
atggggttaactcagtttgaactaactggacacagtgtgtttgattttactcatccatgt
gaccatgaggaaatgagagaaatgcttacacacagaaatggcccagtgagaaaaggaaaa
gaacaaaacacacagcggagcttttttctcagaatgaagtgcaccctaacaagccggggg
aggacgatgaacatcaagtcagcaacgtggaaggtgcttcactgcacgggccatattcat
gtctatgataccaacagtaaccaacctcagtgtgggtacaagaaaccacccatgacgtgc
ttggtgctgatttgtgaacccattcctcatccgtcaaatattgaaattcctttagacagc
aagacatttctcagtcgacacagcctcgatatgaaattttcttactgtgatgaaagaatt
actgagttgatgggttatgagccggaagaacttttgggccgctcaatttatgaatattat
catgctttggattctgatcatctgaccaaaactcaccatgatatgttcactaaaggacaa
gtcaccacaggacagtacaggatgcttgccaaaagaggcggatacgtctgggttgaaact
caagcaactgtcatatataatacgaagaactcccagccacagtgcattgtgtgtgtgaat
tatgttgtaagtggtattattcagcacgacttgattttctcccttcaacaaacagaatct
gtgctcaaaccagttgaatcttcagatatgaagatgactcagctgttcaccaaggttgaa
tcagaggatacaagctgcctttttgataagcttaagaaggagcctgacgctctcactctg
ctggctccagctgctggcgacaccatcatctctctggattttggcagcgatggtcagtgc
ttagacacagaaactgaagatcaacaacttgaagatgttccattatataatgatgtaatg
tttccttcttctaatgaaaaattaaatataaacctggcaatgtctcctttacctgcgtct
gaaacgccaaagccacttcgaagtagtgctgatcctgcactgaatcaagaggttgcatta
aaattagaatcaagtccagagtcactgggactttcttttaccatgccccagattcaagat
cggccagcaagtccttctgatggaagcactagacaaagttcacctgagcctaacagtccc
agtgaatattgctttgatgtggatagcgatatggtcaatgtattcaagttggaactggtg
gaaaaactgtttgctgaagacacagaggcaaagaatccattttcaactcaggacactgat
ttagacttggagatgctggctccctatatcccaatggatgatgatttccagttacgttcc
tttgatcagttgtcaccattagagagcaattctccaagccctccaagtatgagcacagtt
accgggttccagcagacccagttacagaaacctaccatcactgccactgccaccacaact
gctaccactgccaccaccgatgaatcaaaaacagagacaaaggacaataaagaagatatt
aaaatactgattgcatctccatcttctacccaagtacctcaagaaacgaccactactaag
gcatcagcatacagtggcactcacagtcggacagcctcaccagacagagcaggaaagaga
gtcatagaacagacagacaaagctcatccaaggagccttaacctgtctgtcactttgaat
caaagaaatactgttcctgaggaagaattaaacccaaagacaatagcttcgcagaatgct
cagaggaagcgaaaaatggaacatgatggctccctttttcaagcagcaggaattggaaca
ttactgcagcaaccaggtgactgtgcacctgctatgtcactttcttggaaacgagtaaaa
ggattcatatctagtgaacagaatggaacggagcaaaagacaattattttaataccctcc
gacttagcctgtaggctgctggggcagtcaatggatgagagtggattaccacagctgacc
agttacgactgtgaagttaatgctcctatacaaggcagcagaaacctactgcagggtgaa
gaattactcagagctttggatcaagttaactga

KEGG   Mus caroli (Ryukyu mouse): 110312404
Entry
110312404         CDS       T05910                                 

Gene name
Epas1
Definition
(RefSeq) endothelial PAS domain-containing protein 1
  KO
K09095  hypoxia-inducible factor 2 alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05200  Pathways in cancer
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110312404 (Epas1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110312404 (Epas1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110312404 (Epas1)
   04131 Membrane trafficking [BR:mcal04131]
    110312404 (Epas1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    110312404 (Epas1)
Membrane trafficking [BR:mcal04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    110312404 (Epas1)
SSDB
Motif
Pfam: PAS_3 PAS_11 HIF-1a_CTAD HIF-1 PAS PAS_9 PAS_4 Corona_I HLH
Other DBs
NCBI-GeneID: 110312404
NCBI-ProteinID: XP_021041623
Ensembl: MGP_CAROLIEiJ_G0021937
UniProt: A0A6P5R9F8
LinkDB
Position
17
AA seq 874 aa
MTADKEKKRSSSELRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG
LTQVELTGHSIFDFTHPCDHEEIRENLTLKTGSGFGKKSKDVSTERDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVRVYNNCPPHSSLCGSKEPLLSCLIIMCEPIQHPSHMDIPLD
SKTFLSRHSMDMKFTYCDDRILELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKG
QVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTE
SLFKPHLMSMNSIFDSSDDVAVTEKSNYLFTKLKEEPEELAQLAPTPGDAIISLDFGSQN
FDEPSAYGKAILPPGQPWATGLRSHSAQSESGSLPAFTVPQAGTPGNTTPSASSSSSCST
PSSPEDYYSSLENPLKIEVIEKLFAMDTESRDPCSTQTDFSELDLETLAPYIPMDGEDFQ
LSPICPEEPLMPESPQPTPQHCFSTMTSIFQPLTPGATHGPFFLDKYPQQLESRKTESEH
WPMSSIFFDAGSKGSLSPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWPVGDQGAEP
LGALPVGSSQLEPPSAPPHVSMFKMRSAKDFGARGPYMMSPAMIALSNKLKLKRQLEYEE
QAFQDTSGGDPPGTSSSHLMWKRMKSLMGGTCPLMPDKTISANMAPDEFTQKSMRGLGQP
LRHLPPPQPPSTRSSGENAKTGFPPQCYASQFQDYGPPGAQKVSGVASRLLGPSFEPYLL
PELTRYDCEVNVPVPGSSTLLQGRDLLRALDQAT
NT seq 2625 nt   +upstreamnt  +downstreamnt
atgacagctgacaaggagaagaaaaggagcagctccgagctgaggaaggagaaatcccga
gatgccgcgaggtgccggcgcagcaaggagacggaggtcttctatgagttggctcatgag
ttgcccctgcctcacagtgtgagctcccatctagacaaagcctccatcatgcgcctggcc
atcagcttccttcggacacataagctcctgtcctcagtctgctctgaaaatgaatccgaa
gcggaggccgaccagcaaatggataacttgtacctgaaagccttggagggtttcattgcg
gtggtgacccaagatggtgacatgatctttctgtcggaaaacatcagcaagttcatggga
cttacccaggtagaactaacaggacatagcatctttgacttcactcatccttgcgaccat
gaggaaatccgtgagaacctgactctcaaaaccggttctggttttgggaagaagagcaaa
gacgtgtccaccgagcgtgacttcttcatgaggatgaagtgcacggtcaccaacagaggc
cggactgtcaacctcaagtcggccacctggaaggtcctgcactgcaccgggcaagtgaga
gtctacaacaactgcccccctcacagtagcctctgtggctccaaggagcccctgctgtcc
tgccttatcatcatgtgtgagccaatccagcacccatcccacatggacatccccctggac
agcaagactttcctgagccgccacagcatggacatgaagttcacctactgtgacgacaga
atcttggaactgattggttaccaccccgaggagctacttggccgctctgcctatgagttc
taccatgccctggattcggagaacatgaccaaaagtcaccagaacttgtgcaccaagggg
caggtggtatctggccagtaccggatgctagccaaacacggaggatatgtgtggctggag
acccaggggacggtcatctacaacccccgcaacctgcagcctcagtgcatcatgtgtgtc
aactatgtgctgagtgagatcgagaagaacgacgtggtgttctccatggaccagaccgaa
tccctgttcaagccgcacctgatgtccatgaacagcatctttgacagcagtgatgatgtg
gccgtaactgagaagagcaactacctgttcaccaaactgaaggaggagcccgaggaactg
gcccagttggcccccaccccgggagatgccattatttctctcgatttcggaagccagaac
ttcgatgaaccctcagcctatggcaaagccatccttcccccaggccagccatgggccacg
gggctgaggagccacagtgcccagagtgagtccgggagcctgccagccttcactgtgccc
caggcaggcaccccagggaacaccacacccagcgcttcaagcagcagtagctgctccacg
cccagcagccctgaggattactattcatctctggagaatcccttgaagatcgaagtgatt
gagaagcttttcgccatggacacggagtcgagggacccgtgcagtacccagacggacttc
agtgaactggacttggagaccttggcaccctacatccctatggacggcgaggacttccag
ctgagtcccatctgcccagaggagccgctcatgccagagagcccccagcccaccccccag
cactgcttcagtaccatgaccagcatcttccagccgctcaccccgggggccacccacggc
cccttcttcctcgataagtacccgcagcagttggaaagcaggaagacagagtcggagcac
tggcccatgtcttccatcttctttgatgctgggagcaaagggtccctgtctccatgctgt
ggccaggccagcacccctctctcttctatggggggcagatccaacacgcagtggcccccg
gatccaccattacatttcggccctactaagtggcctgtgggtgatcagggtgctgaaccc
ctaggagccctgccggtggggtcatcgcagttggaacctccgagcgccccgcctcacgtc
tccatgttcaagatgaggtctgcaaaggacttcggggcccgaggtccatacatgatgagc
ccagccatgatcgccctgtccaacaagctgaagctaaagcggcagctggagtatgaggag
caagccttccaagacacaagcgggggggaccctccaggcaccagcagttcacacttgatg
tggaaacgtatgaagagcctcatgggcgggacctgtcctttgatgcctgacaagaccatc
agtgcgaacatggcccccgatgaattcacccaaaaatctatgagaggcctgggccagcca
ctgagacacctgccacctccccagccaccatctaccaggagctcaggggagaacgccaag
actgggttcccgccacagtgctatgcctcccagttccaggactacggtcctccaggagct
caaaaggtgtcaggcgtggccagtcgactgctggggccatcgtttgagccttacctgttg
ccggaactgaccagatatgactgtgaggtgaacgtgcccgtgcctggaagctccacactc
ctgcaggggagagaccttctcagagctctggaccaggccacctga

DBGET integrated database retrieval system