KEGG   Mus caroli (Ryukyu mouse): 110306748
Entry
110306748         CDS       T05910                                 

Gene name
Max
Definition
(RefSeq) protein max isoform X1
  KO
K04453  Max protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110306748 (Max)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110306748 (Max)
   05202 Transcriptional misregulation in cancer
    110306748 (Max)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110306748 (Max)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110306748 (Max)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    110306748 (Max)
SSDB
Motif
Pfam: HLH Filament DUF5716 Jnk-SapK_ap_N SlyX bZIP_2 DUF5595 ZapB DUF4763 ATG16 Csm1_N
Other DBs
NCBI-GeneID: 110306748
NCBI-ProteinID: XP_021034488
Ensembl: MGP_CAROLIEiJ_G0017874
UniProt: A0A6P5QYP5
LinkDB
Position
12
AA seq 160 aa
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR
AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN
SLYTNAKGGTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
NT seq 483 nt   +upstreamnt  +downstreamnt
atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct
gcggctgacaagcgggctcaccataatgcactggaacgaaaacgtagggaccacatcaaa
gacagctttcacagtttgcgggactcagtcccatcactccaaggagagaaggcatcccgg
gcccaaatcctagacaaagcaacagagtatatccagtatatgcgaaggaaaaaccatacg
caccagcaagacattgatgacctcaagcggcagaatgctcttctggagcaacaagtccgt
gcactggagaaggcaagatcaagtgcccaactgcagaccaactatccctcctcagacaac
agcctctacaccaacgccaagggcggcaccatctctgccttcgatgggggttcagactcc
agctcagagtccgagcctgaagagccccagagcaggaagaaactccggatggaggccagc
taa

DBGET integrated database retrieval system