KEGG   Mus caroli (Ryukyu mouse): 110306864
Entry
110306864         CDS       T05910                                 

Gene name
Nfkbia
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04064  NF-kappa B signaling pathway
mcal04210  Apoptosis
mcal04380  Osteoclast differentiation
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04668  TNF signaling pathway
mcal04722  Neurotrophin signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04926  Relaxin signaling pathway
mcal04931  Insulin resistance
mcal05132  Salmonella infection
mcal05134  Legionellosis
mcal05135  Yersinia infection
mcal05140  Leishmaniasis
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05215  Prostate cancer
mcal05220  Chronic myeloid leukemia
mcal05222  Small cell lung cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110306864 (Nfkbia)
   04668 TNF signaling pathway
    110306864 (Nfkbia)
   04024 cAMP signaling pathway
    110306864 (Nfkbia)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110306864 (Nfkbia)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110306864 (Nfkbia)
   04621 NOD-like receptor signaling pathway
    110306864 (Nfkbia)
   04622 RIG-I-like receptor signaling pathway
    110306864 (Nfkbia)
   04623 Cytosolic DNA-sensing pathway
    110306864 (Nfkbia)
   04625 C-type lectin receptor signaling pathway
    110306864 (Nfkbia)
   04660 T cell receptor signaling pathway
    110306864 (Nfkbia)
   04658 Th1 and Th2 cell differentiation
    110306864 (Nfkbia)
   04659 Th17 cell differentiation
    110306864 (Nfkbia)
   04657 IL-17 signaling pathway
    110306864 (Nfkbia)
   04662 B cell receptor signaling pathway
    110306864 (Nfkbia)
   04062 Chemokine signaling pathway
    110306864 (Nfkbia)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110306864 (Nfkbia)
   04926 Relaxin signaling pathway
    110306864 (Nfkbia)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110306864 (Nfkbia)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110306864 (Nfkbia)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110306864 (Nfkbia)
   05203 Viral carcinogenesis
    110306864 (Nfkbia)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110306864 (Nfkbia)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    110306864 (Nfkbia)
   05215 Prostate cancer
    110306864 (Nfkbia)
   05222 Small cell lung cancer
    110306864 (Nfkbia)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110306864 (Nfkbia)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110306864 (Nfkbia)
   05135 Yersinia infection
    110306864 (Nfkbia)
   05134 Legionellosis
    110306864 (Nfkbia)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110306864 (Nfkbia)
   05170 Human immunodeficiency virus 1 infection
    110306864 (Nfkbia)
   05161 Hepatitis B
    110306864 (Nfkbia)
   05160 Hepatitis C
    110306864 (Nfkbia)
   05171 Coronavirus disease - COVID-19
    110306864 (Nfkbia)
   05164 Influenza A
    110306864 (Nfkbia)
   05162 Measles
    110306864 (Nfkbia)
   05168 Herpes simplex virus 1 infection
    110306864 (Nfkbia)
   05163 Human cytomegalovirus infection
    110306864 (Nfkbia)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110306864 (Nfkbia)
   05169 Epstein-Barr virus infection
    110306864 (Nfkbia)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110306864 (Nfkbia)
   05140 Leishmaniasis
    110306864 (Nfkbia)
   05142 Chagas disease
    110306864 (Nfkbia)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110306864 (Nfkbia)
   04131 Membrane trafficking [BR:mcal04131]
    110306864 (Nfkbia)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    110306864 (Nfkbia)
Membrane trafficking [BR:mcal04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    110306864 (Nfkbia)
SSDB
Motif
Pfam: Ank Ank_2 Ank_5 Ank_3 Ank_4
Other DBs
NCBI-GeneID: 110306864
NCBI-ProteinID: XP_021034659
Ensembl: MGP_CAROLIEiJ_G0017760
UniProt: A0A6P5QTH6
LinkDB
Position
12
AA seq 314 aa
MFQPAGHGQDWAMEGPRDGLKKERLVDDRHDSGLDSMKDEEYEQMVKELREIRLQPQEAP
LAAEPWKQQLTEDGDSFLHLAIIHEEKPLTMEVIGQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPGIAEALLKAGCDPELRDFRGNTPLHLACEQGCLASVAVLTQTCTPQHLHSVLQATN
YNGHTCLHLASIHGYLAIVEHLVTLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL
PYDDCVFGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtttcagccagctgggcacggccaggactgggccatggagggcccgcgggatggcctc
aagaaggagcgcttggtggacgatcgccacgacagcggcctggactccatgaaggacgag
gagtacgagcaaatggtgaaggagctgcgggagatccgcctgcagccgcaggaggcgccg
ctagccgccgagccctggaagcagcagctcacggaggacggagactcgttcctgcacttg
gcaatcatccacgaagagaagccgctgaccatggaagtcattggtcaggtgaagggagac
ctggccttcctcaacttccagaacaacctgcagcagactccactgcacttggctgtgatc
accaaccagccaggaattgctgaagcacttctgaaagctggctgtgatcctgagctccga
gactttcgaggaaatacccctctacatcttgcctgtgagcagggctgcctggccagtgta
gcagtcttgacgcagacctgcacgccccagcatctccactccgtcctgcaggccaccaac
tacaatggccacacgtgtctgcacctagcctctatccatggctacctggccatcgtggag
cacttggtgactttgggtgctgatgtcaacgctcaggagccctgcaatggccggacagcc
ctccaccttgcggtggacctgcagaatcctgacctggtttcgctcttgttgaagtgtggg
gctgatgtcaacagggtaacctaccaaggctactccccctaccagcttacctggggccgc
ccaagtacccggatacagcagcagctgggccagctgaccctggaaaatctccagatgctg
cccgagagcgaggatgaggagagctatgacacagagtcagaattcacagaggatgagctg
ccctatgatgactgtgtgtttggaggccagcgtctgacattataa

DBGET integrated database retrieval system