KEGG   Mus caroli (Ryukyu mouse): 110306919
Entry
110306919         CDS       T05910                                 

Gene name
Jag2
Definition
(RefSeq) protein jagged-2
  KO
K21635  jagged-2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04330  Notch signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal05200  Pathways in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110306919 (Jag2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    110306919 (Jag2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110306919 (Jag2)
  09162 Cancer: specific types
   05224 Breast cancer
    110306919 (Jag2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110306919 (Jag2)
SSDB
Motif
Pfam: EGF hEGF MNNL DSL EGF_2 EGF_CA MFS_2
Other DBs
NCBI-GeneID: 110306919
NCBI-ProteinID: XP_021034735
Ensembl: MGP_CAROLIEiJ_G0018164
UniProt: A0A6P5QTN3
LinkDB
Position
12
AA seq 1247 aa
MRARGWGRLPRRLLLLLVLCVQATRPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAG
GCGRDECDTYVRVCLKEYQAKVTPTGPCSYGYGATPVLGGNSFYLPPAGAAGDRARARSR
TGGHQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPDEELLIERVSHAGMINPEDRWKS
LHFSGHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKEC
KEAVCKQGCNLLHGGCTVPGECRCSYGWQGKFCDECVPYPGCVHGSCVEPWHCDCETNWG
GLLCDKDLNYCGSHHPCVNGGTCINAEPDQYLCACPDGYLGKNCERAEHACASNPCANGG
SCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATC
QLDANECEGKPCLNAFSCKNLIGGYYCDCLPGWKGINCQININDCHGQCQHGGTCKDLVN
GYQCVCPRGFGGRHCELEYDKCASSPCRRGGICEDLVDGFRCHCPRGLSGPHCEVDMDLC
EPSPCLNGARCYNLEGDYYCACPEDFGGKNCSVPRDTCPGGACRVIDGCGFEAGSRARGV
APSGICGPHGHCVSLPGGNFSCICDSGFTGTYCHENIDDCMGQPCRNGGTCIDEVDSFRC
FCPSGWEGELCDINPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYT
CSNGGTCYDSGDTFRCACPPGWKGSTCTIAKNSSCVPNPCVNGGTCVGSGDSFSCICRDG
WEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGA
TCVDEINGYRCSCPPGRSGPRCQEVVIFTRPCWSRGMSFPHGSSWMEDCNSCRCLDGHRD
CSKVWCGWKPCLLSGQPSDLSAQCPPGQQCREKAVGQCLQPPCENWGECTAEEPLPPSTP
CQPRSSHLDNNCARLTLRFNRDQVPQGTTVGAICSGIRALPATRAAAHDRLLLLLCDRAS
SGASAVEVAVSFSPARDLPDSSLIQSTAHAIVAAITQRGNSSLLLAVTEVKVETVVMGGS
STGLLVPVLCSVFSVLWLACVVICVWWTRKRRKERERSRLPRDESANNQWAPLNPIRNPI
ERPGGSGLGTGGHKDVLYQCKNFTPPPRRAGEALPGPAGHGAGGEDEEDEELSRGDGDSP
EAEKFISHKFTKDPSCSLGRPACWAPGPKVDNRAVRSTKDVRRAGRE
NT seq 3744 nt   +upstreamnt  +downstreamnt
atgcgggcacgcggctggggacgcctgcctcggcggctgctgctgctgctggttctgtgc
gtgcaggcgacgcggcccatgggctatttcgagctgcagctgagcgcgctgcggaacgtg
aacggggagctgctgagcggcgcctgctgtgacggcgacggccggacgacgcgcgcgggg
ggctgcggccgcgacgagtgcgacacgtacgtgcgcgtgtgccttaaggagtaccaggcc
aaggtgacgcccacggggccctgcagctacggctacggcgccacgcccgtgctgggtggc
aactccttctacctgccgccggcgggcgctgcgggggaccgagcgcgcgcgcggtctcgg
accggcggccaccaggacccgggcctcgtcgtcattccctttcagttcgcctggccgcgt
tctttcaccctcatcgtggaggcctgggactgggacaatgacaccactccagatgaggag
ctgctgattgagcgggtgtcgcacgctggcatgatcaaccccgaggaccgctggaagagc
ctgcacttcagcggccacgtggcacacctggagctgcagatccgagtgcgctgtgacgag
aactactacagtgccacctgcaacaagttctgccggccccgcaacgacttctttggccac
tatacctgcgaccagtacggcaacaaggcctgcatggatggctggatgggcaaggaatgc
aaagaagccgtgtgtaaacaaggatgtaatttgctccacgggggatgcactgtgcctggg
gagtgcaggtgcagctacggctggcagggcaagttctgtgacgagtgtgtcccctaccct
ggctgcgtgcatggcagctgtgtggaaccctggcactgtgactgtgagaccaactggggt
ggcctgctctgtgacaaagacctgaactactgtggcagccaccacccctgtgtcaacggg
ggtacctgcatcaatgctgagcctgaccaatacctctgcgcctgcccagatggctacttg
ggcaagaactgcgagcgggctgagcacgcctgtgcctccaacccgtgtgccaatgggggc
tcttgccacgaagtgccgtctggctttgaatgccactgtccgtcgggatggagcggaccc
acctgtgcactcgacattgatgagtgtgcctctaacccatgtgcagcgggtggtacctgc
gtggatcaggtggacggcttcgagtgcatctgcccagagcagtgggtgggggctacttgc
cagctggacgccaatgagtgtgaagggaagccgtgccttaatgctttttcttgcaaaaac
ctgattggcggctattactgtgattgcctcccgggctggaagggcatcaactgccaaatc
aacatcaacgattgccatgggcagtgtcagcatgggggcacctgcaaggacctggtcaat
gggtaccagtgtgtgtgcccgcggggctttggaggtcgccattgcgaactagagtacgac
aagtgtgccagcagcccctgccgccggggtggcatctgcgaggacctggtggatggcttc
cgctgccactgcccacggggcctctctgggccacactgtgaggtggacatggatctctgt
gaaccaagcccctgcctcaatggtgctcgctgctacaaccttgagggtgactactactgt
gcctgcccagaagactttggtggcaagaactgctcggtgcccagggacacatgccctggc
ggggcatgtagagtgatcgatggctgcgggtttgaggcagggtccagggcacgcggtgtc
gcgccctctggtatatgtggccctcacgggcactgcgtcagcctgcctgggggaaacttc
tcctgcatctgtgacagcggtttcacaggcacctactgccatgaaaacattgacgactgc
atgggccagccctgccgcaacgggggcacgtgcattgacgaagtggattccttccgctgc
ttctgccccagtggctgggaaggcgaactctgtgacatcaatcccaacgactgcctcccc
gacccctgccacagccgcggccgctgctatgacctggtcaatgacttctactgtgcctgt
gacgatggctggaagggcaagacctgccactcacgcgagttccagtgtgatgcctacacc
tgcagcaacggtggcacatgctatgacagcggtgacaccttccgctgcgcgtgccctccg
ggctggaagggcagcacctgcaccatcgccaagaacagcagctgtgtgcccaatccctgt
gtgaatggaggcacctgcgtgggcagcggagactctttctcctgcatctgccgggatggc
tgggagggccgcacctgcacacataacaccaatgactgcaaccctctaccctgctataac
ggaggcatctgtgttgatggcgtcaactggttccgctgcgagtgtgcgcctggctttgcg
ggtcctgactgccgtatcaacatcgatgagtgccagtcctcgccctgtgcctacggagcc
acgtgtgtggatgagatcaacgggtaccgctgcagctgcccaccaggtcgttctggcccc
aggtgccaggaagtggtcatattcacgaggccctgctggtcccggggcatgtccttcccg
cacgggagttcctggatggaagactgcaacagctgccgctgcctggatggccaccgggat
tgcagcaaggtatggtgcggatggaagccttgcctgctctctggtcagcccagcgatctg
agtgcccagtgccccccagggcagcaatgtcgggagaaggccgtgggtcagtgcctgcag
ccaccctgtgagaactggggggagtgtacagcagaggagcctctgccacccagcaccccc
tgtcagccacggagcagtcatttggacaacaactgtgctcgactcacactgcgcttcaac
cgtgatcaagtgcctcagggcaccactgtgggcgctatctgttctggaatccgagccttg
cctgccacgagggcagcggcacacgaccgcctcctcctgctgctctgtgatcgagcatcc
tcgggggctagtgctgtggaggtggctgtgtctttcagccctgcaagggacctgcctgac
agcagcctgatccagagcacagcccacgccatcgtggctgctatcactcagagaggaaat
agctcactgctgctggctgtcaccgaggtcaaggtggaaacagttgttatgggtggctct
tccacaggtctgttggtacccgtgctgtgcagcgtgttcagtgtgctgtggctcgcctgt
gtggttatctgcgtatggtggacacgaaagcgcaggaaagaacgtgagaggagccggcta
ccacgggatgagagcgccaacaaccagtgggccccgctcaatcccatccgcaaccccatt
gagcggccaggcggcagcggtctgggaactgggggtcacaaggacgtactctaccagtgc
aaaaacttcacaccaccgccccgcagggcaggcgaggcactgcccgggccagctggccat
ggggctggcggggaggacgaggaggacgaggagctgagccgtggagatggggactcccca
gaggcagagaagttcatctcacacaaattcaccaaagaccccagctgctcccttggaagg
ccagcctgctgggctccagggcccaaagtggacaaccgcgccgtcagaagcaccaaggat
gtgcgccgtgctggcagggagtag

KEGG   Mus caroli (Ryukyu mouse): 110310272
Entry
110310272         CDS       T05910                                 

Gene name
Jag1
Definition
(RefSeq) protein jagged-1
  KO
K06052  jagged-1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04330  Notch signaling pathway
mcal04371  Apelin signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04668  TNF signaling pathway
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110310272 (Jag1)
   04371 Apelin signaling pathway
    110310272 (Jag1)
   04668 TNF signaling pathway
    110310272 (Jag1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    110310272 (Jag1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110310272 (Jag1)
  09162 Cancer: specific types
   05224 Breast cancer
    110310272 (Jag1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110310272 (Jag1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110310272 (Jag1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcal04090]
    110310272 (Jag1)
CD molecules [BR:mcal04090]
 Proteins
  110310272 (Jag1)
SSDB
Motif
Pfam: EGF hEGF MNNL EGF_2 DSL EGF_CA cEGF EGF_3
Other DBs
NCBI-GeneID: 110310272
NCBI-ProteinID: XP_021038725
Ensembl: MGP_CAROLIEiJ_G0024360
UniProt: A0A6P5R2B1
LinkDB
Position
2
AA seq 1218 aa
MRSPRTRGRPGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGVRN
PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRI
VLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFE
YQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSP
KHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSSGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNARSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYA
GDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQC
YNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWE
GAHCENNINDCSQNPCHYGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEVDTFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGDSFTCVCKEGWEGPICT
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYQCICPPGHSGAKCHEVSGRSCITMGRVILDGAKWDDDCNTCQCLNGRVACSKVWCGPR
PCRLHKSHNECPSGQSCIPVLDDQCFVRPCTGVGECRSSSLQPVKTKCTSDSYYQDNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSLSANNEIHVAISAED
IRDDGNPVKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVA
WVCCLVTAFYWCVRKRRKPSSHTHSAPEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYE
NKNSKMSKIRTHNSEVEEDDMDKHQQKVRFAKQPVYTLVDREEKAPSGTPTKHPNWTNKQ
DNRDLESAQSLNRMEYIV
NT seq 3657 nt   +upstreamnt  +downstreamnt
atgcggtccccacggacgcgcggccggcccgggcgccccctgagtcttctgctcgccctg
ctctgtgccctgcgagccaaggtgtgcggggcctcgggtcagtttgaactggagatcctg
tccatgcagaacgtgaatggagagctacagaatgggaactgttgtggtggagtccggaac
cctggcgaccgcaagtgcacccgcgacgagtgtgacacgtacttcaaagtgtgcctcaag
gagtatcagtcccgcgtcacggccgggggaccctgcagcttcggctcagggtctacgcct
gtcatcgggggcaacaccttcaatctcaaggccagccgcggcaacgaccgtaatcgcatc
gtactgcctttcagtttcgcctggccgaggtcctacactttgctggtggaggcctgggat
tccagtaatgacactattcaacctgatagcataattgaaaaggcttctcactcaggcatg
ataaaccctagccggcaatggcagacactgaaacaaaacacagggattgcccacttcgag
tatcagatccgcgtgacctgtgatgaccactactatggctttggctgcaataagttctgt
cgtcccagagatgacttctttggacattatgcctgtgaccagaatggcaacaaaacttgc
atggaaggctggatgggtcctgattgcaacaaagctatctgccgacagggctgcagtccc
aagcatgggtcttgtaaacttccaggtgactgcaggtgccagtacggttggcagggtctg
tactgcgacaagtgcatcccgcacccaggatgtgtccacggcacctgcaatgaaccctgg
cagtgcctctgtgagaccaactggggtggacagctctgtgacaaagatctgaattactgt
gggactcatcagccctgtctcaaccggggaacatgtagcaacactgggcctgacaaatac
cagtgctcctgcccagagggctactcgggccccaactgtgaaattgctgagcatgcttgt
ctctctgacccctgccataaccgaggcagctgcaaggagacctcctcaggctttgagtgt
gagtgttctccaggctggactggacccacgtgttccacaaacatcgatgactgttctcca
aataactgttcccatgggggcacctgccaggatctggtgaatggattcaagtgtgtgtgc
ccaccccagtggactggcaagacttgtcagttagatgcaaatgagtgcgaggccaaacct
tgtgtaaatgccagatcctgtaagaatctgattgccagctactactgtgattgccttcct
ggctggatgggtcagaactgtgacataaatatcaatgactgccttggccagtgtcagaat
gacgcctcctgtcgggatttggttaatggttatcgctgtatctgtccacctggctatgca
ggcgatcactgtgagagagacatcgatgagtgtgctagtaacccctgcttgaatgggggt
cactgtcagaatgaaatcaacagattccagtgtctctgtcccactggtttctctggaaac
ctctgtcagctggacatcgattactgcgagcccaacccttgccagaatggcgcccagtgc
tacaatcgtgccagtgactatttctgcaagtgccccgaggactatgagggcaagaactgc
tcacacctgaaagaccactgccgtaccaccccctgcgaagtgattgacagctgcactgtg
gccatggcctccaacgacacgcctgaaggggtgcggtatatctcttctaacgtctgtggt
ccccatgggaagtgcaagagccagtcgggaggcaaattcacctgtgactgtaacaaaggc
ttcaccggcacctactgccatgaaaatatcaacgactgcgagagcaacccctgtaaaaac
ggtggcacctgcatcgatggcgttaactcctacaagtgtatctgtagtgacggctgggag
ggagcgcactgtgagaacaacataaatgactgtagccagaacccttgtcactacgggggt
acatgtcgagacctggtcaatgacttttactgtgactgcaaaaatggctggaaaggaaag
acttgccattcccgtgacagccagtgtgacgaagccacgtgtaataatggtggtacctgc
tatgatgaagtggatacgtttaagtgcatgtgtcccggtggctgggaaggaacaacctgt
aatatagctagaaacagtagctgcctgccgaacccctgtcataatggaggtacctgcgtg
gtcaatggagactccttcacctgtgtctgcaaagaaggctgggaggggcctatttgtact
caaaataccaacgactgcagtccccatccttgttacaatagcgggacctgtgtggacgga
gacaactggtatcggtgcgaatgtgctccgggttttgctgggccagactgcaggataaac
atcaatgagtgccagtcttccccttgtgcctttggggccacctgtgtggatgagatcaat
ggctaccagtgcatctgccctccaggacatagtggtgccaagtgccatgaagtttcaggg
cgatcttgcatcaccatggggagagtgatacttgatggggccaagtgggatgatgactgt
aacacctgccagtgcctgaatggacgggtggcctgctccaaggtctggtgtggcccgaga
ccttgccggctccacaaaagccacaatgagtgccccagtgggcagagctgcatcccagtc
ctggatgaccagtgtttcgtgcgcccctgcactggtgttggcgagtgtcggtcctccagc
ctccagccagtgaagaccaagtgcacatctgactcctattaccaggataactgtgcaaac
atcactttcacctttaacaaagagatgatgtctccaggtcttaccaccgaacacatttgc
agcgaactgaggaatttgaatattctgaagaatgtttctgctgaatattcgatctacata
gcctgtgagccttccctgtcagcaaacaatgaaatacacgtggccatttctgcagaagac
atccgggatgatgggaaccctgtcaaggaaattactgataaaataatagatctcgttagt
aaacgggatggaaacagctcacttattgctgctgttgcagaagtcagagttcagaggcgt
cctctgaaaaacagaacagatttcctggttcctctgctgagctctgtcttaacagtggct
tgggtctgttgcttggtgacagccttctactggtgtgtacggaagcggcggaagcccagc
agccacactcactccgcccccgaggacaacaccaccaacaatgtgcgggagcagctgaac
caaatcaaaaaccccatcgagaaacacggagccaacacggtccccattaaggattacgag
aacaaaaactccaaaatgtcaaaaatcaggacacacaactcggaggtggaggaggatgac
atggataaacaccagcagaaagtccgctttgccaaacagccagtgtacacgctggtagac
agagaggagaaggcccccagcggcacgccgacaaaacacccgaactggacaaataaacag
gacaacagagacttggaaagtgcccagagcttgaaccggatggaatacatcgtatag

DBGET integrated database retrieval system