KEGG   Mus caroli (Ryukyu mouse): 110306954
Entry
110306954         CDS       T05910                                 

Gene name
Traf3
Definition
(RefSeq) TNF receptor-associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04064  NF-kappa B signaling pathway
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04668  TNF signaling pathway
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110306954 (Traf3)
   04668 TNF signaling pathway
    110306954 (Traf3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110306954 (Traf3)
   04621 NOD-like receptor signaling pathway
    110306954 (Traf3)
   04622 RIG-I-like receptor signaling pathway
    110306954 (Traf3)
   04657 IL-17 signaling pathway
    110306954 (Traf3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110306954 (Traf3)
   05203 Viral carcinogenesis
    110306954 (Traf3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110306954 (Traf3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110306954 (Traf3)
   05160 Hepatitis C
    110306954 (Traf3)
   05171 Coronavirus disease - COVID-19
    110306954 (Traf3)
   05164 Influenza A
    110306954 (Traf3)
   05162 Measles
    110306954 (Traf3)
   05168 Herpes simplex virus 1 infection
    110306954 (Traf3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110306954 (Traf3)
   05169 Epstein-Barr virus infection
    110306954 (Traf3)
   05165 Human papillomavirus infection
    110306954 (Traf3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 ATG16 Crescentin MPS2 zf-C3HC4_2 Spc7 Spc29 Cast zf-RING_4 Tropomyosin_1 KxDL T3SSipB FliJ BLOC1_2 DUF1664 Exonuc_VII_L GAS DUF3450 SPATA24
Other DBs
NCBI-GeneID: 110306954
NCBI-ProteinID: XP_021034790
Ensembl: MGP_CAROLIEiJ_G0018127
UniProt: A0A6P7RYT9
LinkDB
Position
12
AA seq 567 aa
MESSKKMDAAGTLQPNPPLKLQPDRGAGSVLVPEQGGYKEKFVKAVEDKYKCEKCRLVLC
SPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQIYCRNEG
RGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCK
SQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVF
QGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIE
IERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRV
TELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWK
IRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGE
YDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQT
VLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggagtcaagcaaaaagatggatgctgctggcacactgcagcctaacccacccctaaag
ctgcagcctgatcgcggcgcagggtccgtgctcgtgccggagcaaggaggctacaaggag
aagtttgtgaaggcggtggaagacaagtacaaatgcgagaagtgccgcctggtgctgtgc
agcccgaagcagacggagtgtggccaccggttctgcgagagctgcatggccgccctgctg
agctcctccagtccaaaatgcacagcgtgccaagaaagcatcatcaaagacaaggtgttt
aaggataattgctgcaagagggagattctggcccttcagatctactgtcggaatgaaggc
agaggttgtgcggagcagctgactctgggacatctgctggtgcacctaaaaaatgaatgt
cagtttgaggaacttccctgtctgcgtgctgactgcaaagaaaaagtactgagaaaagac
ttacgggatcacgtggaaaaggcctgtaaataccgcgaggccacgtgcagtcactgcaag
agccaagtgcccatgatcaaactgcagaaacacgaagacacggattgtccctgcgtggtg
gtgtcctgccctcacaagtgcagcgttcagactcttctaaggagtgagttgagtgcacac
ttgtccgagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgttttt
cagggtacaaaccagcagatcaaggcccatgaggccagctccgcggtacagcacgtgaac
ctgctgaaggagtggagcaactccctggagaagaaggtttccctactgcagaatgaaagt
gttgagaaaaacaagagcatacaaagcctgcacaaccagatctgcagctttgagatcgag
attgagaggcagaaggagatgctccgaaacaacgagtccaagatccttcacctgcagcgg
gtaatcgacagccaagcagagaaactgaaagaactggacaaggagatccgtcccttccgg
cagaactgggaggaagcggacagcatgaagagcagtgtggagtccctccagaaccgagtg
actgagctggagagcgtagacaaaagtgcggggcaggccgctcgcaacacaggcttgctg
gagtcccagctgagccggcatgaccagatgttgagtgttcatgacatccgcttggccgac
atggacctgcggttccaggtcctcgaaaccgccagctacaatggggtgctgatctggaag
atccgtgactacaagcgccggaagcaggaggctgtcatggggaagaccctgtctctctac
agccagcctttctacacaggttattttggctataagatgtgtgccagggtctacctgaat
ggggacggaatggggaaagggacacacttgtcgctgttttttgtcattatgcgtggagaa
tatgatgctctgttgccatggccgttcaagcagaaagtgacacttatgctgatggatcag
gggtcctctcgccgtcatctgggagatgcgttcaagcccgaccccaacagcagtagcttc
aagaaacccaccggagagatgaatatcgcctctggctgcccagtctttgtcgcccaaact
gttctagagaacgggacgtatattaaagatgatacaatttttattaaagtcatagtggat
acctcggatctgcctgacccctga

DBGET integrated database retrieval system