KEGG   Mus caroli (Ryukyu mouse): 110306968
Entry
110306968         CDS       T05910                                 

Gene name
Sos2
Definition
(RefSeq) son of sevenless homolog 2
  KO
K03099  son of sevenless
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04062  Chemokine signaling pathway
mcal04068  FoxO signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04540  Gap junction
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04714  Thermogenesis
mcal04722  Neurotrophin signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal04910  Insulin signaling pathway
mcal04912  GnRH signaling pathway
mcal04915  Estrogen signaling pathway
mcal04917  Prolactin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04935  Growth hormone synthesis, secretion and action
mcal05034  Alcoholism
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110306968 (Sos2)
   04012 ErbB signaling pathway
    110306968 (Sos2)
   04014 Ras signaling pathway
    110306968 (Sos2)
   04630 JAK-STAT signaling pathway
    110306968 (Sos2)
   04068 FoxO signaling pathway
    110306968 (Sos2)
   04072 Phospholipase D signaling pathway
    110306968 (Sos2)
   04151 PI3K-Akt signaling pathway
    110306968 (Sos2)
   04150 mTOR signaling pathway
    110306968 (Sos2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110306968 (Sos2)
   04540 Gap junction
    110306968 (Sos2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110306968 (Sos2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110306968 (Sos2)
   04660 T cell receptor signaling pathway
    110306968 (Sos2)
   04662 B cell receptor signaling pathway
    110306968 (Sos2)
   04664 Fc epsilon RI signaling pathway
    110306968 (Sos2)
   04062 Chemokine signaling pathway
    110306968 (Sos2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110306968 (Sos2)
   04912 GnRH signaling pathway
    110306968 (Sos2)
   04915 Estrogen signaling pathway
    110306968 (Sos2)
   04917 Prolactin signaling pathway
    110306968 (Sos2)
   04926 Relaxin signaling pathway
    110306968 (Sos2)
   04935 Growth hormone synthesis, secretion and action
    110306968 (Sos2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110306968 (Sos2)
  09159 Environmental adaptation
   04714 Thermogenesis
    110306968 (Sos2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110306968 (Sos2)
   05206 MicroRNAs in cancer
    110306968 (Sos2)
   05205 Proteoglycans in cancer
    110306968 (Sos2)
   05231 Choline metabolism in cancer
    110306968 (Sos2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110306968 (Sos2)
   05225 Hepatocellular carcinoma
    110306968 (Sos2)
   05226 Gastric cancer
    110306968 (Sos2)
   05214 Glioma
    110306968 (Sos2)
   05221 Acute myeloid leukemia
    110306968 (Sos2)
   05220 Chronic myeloid leukemia
    110306968 (Sos2)
   05211 Renal cell carcinoma
    110306968 (Sos2)
   05215 Prostate cancer
    110306968 (Sos2)
   05213 Endometrial cancer
    110306968 (Sos2)
   05224 Breast cancer
    110306968 (Sos2)
   05223 Non-small cell lung cancer
    110306968 (Sos2)
  09165 Substance dependence
   05034 Alcoholism
    110306968 (Sos2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110306968 (Sos2)
   05160 Hepatitis C
    110306968 (Sos2)
   05163 Human cytomegalovirus infection
    110306968 (Sos2)
   05165 Human papillomavirus infection
    110306968 (Sos2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110306968 (Sos2)
   01522 Endocrine resistance
    110306968 (Sos2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcal04990]
    110306968 (Sos2)
Domain-containing proteins not elsewhere classified [BR:mcal04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   110306968 (Sos2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_19
Other DBs
NCBI-GeneID: 110306968
NCBI-ProteinID: XP_021034812
Ensembl: MGP_CAROLIEiJ_G0017808
UniProt: A0A6P5QTT3
LinkDB
Position
12
AA seq 1333 aa
MQQAPQPYEFFSEENSPKWRGLLVPALRKVQEQVHPTLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
DIGLVSLCEDEPCSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLLDRKLFKPSE
IEKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQD
ILAPEFNDHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLK
ACSEEQEDKECLNQAITALMNLQGSMDRIYKQHSPRRRPGDPVCLFYNRQLRSKHLAIKK
MNEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHGQTRLP
GYSSAEYRLKEKFVMRKIQICDKEDTCEYRHAFELVSKDENSVIFAAKSAEEKNNWMAAL
ISLHYRSTLDRMLDSVLLKEENEQPLRLPSPDMYRFVVTDSEENIVFEDNLQSRSGIPII
KGGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKL
ALEKGEQPISADLKRFRKEYVQPVQLRVLNVFRHWVEHHYYDFERDLELLERLESFISSV
RGKAMKKWVESIAKIIKRKKQAQANGISHNITFESSPPPVEWHISRTGQLETFDLMTLHP
IEIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVE
AENFEERVAVLSRIVEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRIL
DDAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNSDFLKRKGKDLINFSKR
RKVAEITGEIQQYQNQPYCLRTEPEMRRFFENLNPMGILSEKEFTDYLFNKSLEIEPRNC
KQPPRFPRKSTFSLKSPGIRPNAGRHGSTSGTLRGHPTPLEREPYKISFSRIAETELEST
VSAPTSPNTPSTPPVSASSDHSVFLDVDLNSSCGSNTIFAPVLLPHSKTFFSSCGSLHKL
SEEPRIPPPLPPRKKFDHDAPSSKGALKSDDDPPAIPPRQPPPPKVKPRVPVLMGTFDGP
VPSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHPHRDPDWLRDVSTCPNSP
STPPTTPSPRIPRSCHLLSSSHSSLAHLPAPPVPPRQNSSPLLPKLPPKTYKRELSHPPL
YRLPLLENAETPQ
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccctacgagttcttcagcgaagaaaacagcccgaaatggcgg
ggactattggtcccggccctgcggaaggttcaggagcaagtacatcccaccctctcagct
aatgaagagtctctctattatattgaagaactgatttttcagctgcttaataagctatgc
atggctcaaccaaggactgttcaagatgttgaggaacgagttcaaaagacctttcctcat
cctattgataaatgggcaattgctgatgcacagtctgctatagagaaacgaaaacgaaga
aatcctctcttactacctgtggacaaaatccatccttccttgaaggaagttttggggtat
aaagtggactaccatgtgtccctctacattgtggctgtattggagtatatctcagcagat
attttgaaattggctggtaattatgtttttaatatccggcattatgaaatatctcagcaa
gacattaaagtgtccatgtgtgcagataaggttttgatggacatgtttgatcaggatgat
gatataggcttggtttctctctgtgaagatgaaccttgttcttctggtgagctaaactat
tatgacctcgtcaggactgaaattgcagaagaaagacagtatctacgggagctgaatatg
atcattaaagtgttccgggaagcctttctcttggacagaaagttgttcaagccttctgaa
attgaaaagattttcagcaacatttcagatatccatgaattgactgtgaaacttttaggt
ttaattgaagacacagtagaaatgacagatgaaagtagtcctcatccattagctggtagc
tgttttgaagatttagcagaggagcaagcgtttgatccctatgaaacattatcacaggac
attcttgcaccagagtttaatgaccacttcagcaagttgatggccagacctgcagttgct
ctacattttcagtccattgctgacggctttaaggaggctgttcgttatgtccttccgcgc
ctcatgctggtgcccgtgtatcactgttggcattactttgaattattaaagcagttgaag
gcatgcagtgaagagcaggaggacaaagagtgcttgaatcaggctatcactgccctcatg
aacctgcaaggcagcatggaccgcatttacaagcagcactcccccagacgccggcccggg
gatccagtttgccttttttacaatcgtcaattaagaagcaaacacctggctatcaaaaaa
atgaatgaaattcagaaaaacatagatgggtgggaaggcaaagatatcggacagtgttgt
aatgagttcataatggagggaccattgaccagaattggtgctaaacacgaaaggcatata
tttctctttgatggcttaatgatcagctgtaaacccaatcatggccagacccggcttcca
ggatatagcagtgcagaatacagattaaaggagaagtttgtcatgaggaaaattcaaatc
tgtgataaggaagacacctgtgagtacagacatgcttttgaattagtgtccaaagatgaa
aacagtgtaatatttgctgccaaatcagctgaagagaaaaacaactggatggcagccctc
atttccctgcactatcgcagcactctagacagaatgctggactctgtgctgctgaaagaa
gagaatgagcagcccctgaggctacccagtccagatatgtatcgctttgtggtaacagac
tctgaggaaaacattgtgtttgaagacaacttgcaaagcagaagtggcatccccataatt
aaaggaggcactgtggtgaaactgatcgaaaggctaacataccacatgtatgcagatccc
aattttgttcgtacttttcttactacatatcgttcattttgtaaaccacaggaattgcta
agcttgctgatagaaaggtttgaaattccagaaccagaacccactgaggcagacaagctg
gcgttagagaaaggcgagcagccaatcagcgcagatctgaaaagattccgcaaggaatat
gtccaacctgtgcaacttagggtcttgaatgtctttcgccactgggttgagcatcattat
tatgactttgaaagagacttggaattgcttgaaagactagaatccttcatttcaagtgta
agagggaaagccatgaagaaatgggtagaatccattgctaagataatcaagaggaagaag
caagctcaggcaaatggaataagccataatatcacctttgaaagctcccctccaccagtg
gaatggcacatcagtagaacaggacagcttgaaacatttgaccttatgacactccatcca
atagagatcgcacggcagctaacgcttttggaatctgacctctacaggaaagtccagccc
tctgaacttgtagggagtgtctggaccaaagaagataaagaaatcaattctccaaattta
ttaaaaatgattcgccatacaacaaacctcactctatggtttgaaaaatgcattgtggaa
gcagaaaactttgaagagcgggtggcagtgctcagcagaatagtagaaattctgcaagta
tttcaagacttgaataatttcaatggcgtgttggagatagtgagtgcagtcaactccgtg
tcagtgtacaggctagaccacacgtttgaggcattgcaggaaaggaagcggagaattttg
gatgacgctgtggaactaagtcaggatcactttaaaaaatacctagtaaaacttaaatca
atcaatccgccttgtgtgcctttttttggaatatatttaacaaatattctgaagactgaa
gaagggaacagtgactttctaaagaggaaagggaaagatttgatcaatttcagtaagagg
aggaaagtggctgaaataactggagagatccagcagtatcagaaccaaccgtactgctta
cggacagaaccagaaatgaggagattctttgaaaacctcaaccccatgggaattttatct
gaaaaagagtttacagattatttgttcaacaaatcattagaaatcgaaccccgaaactgc
aaacaaccacctcgatttcctaggaagtcaaccttttccttaaaatctcctggaataagg
cccaatgctggccgccatggctctacctcgggcacgctacgaggtcacccaacgcctctg
gaaagagagccttataagataagctttagccggattgcagagacagagctagaatcaaca
gtgtctgcaccaacctctcccaacactccatccaccccaccagtgtctgcttcttcagac
cacagtgtgtttctagatgtggacctcaatagctcctgtggcagcaacaccatctttgct
ccagtcctcttgccacactcaaagactttcttcagctcatgtggaagtttacacaaactg
agtgaagagccacgaattcctcctccgcttccccctcggaaaaagtttgaccatgatgct
cccagttccaagggagctctgaagtctgatgatgaccctcctgctattccaccaagacag
ccccctcctccaaaggtaaagccgagagttcctgtcctcatgggtacatttgatgggcct
gtgcccagtccacctccacctcctccaagagaccctcttcctgatacccctccaccagtt
cctcttcggcctccggaacactttataaactgtccatttaatcttcagccacctccactg
ggccatcctcacagagacccagactggctaagagacgttagcacgtgtcctaactcacca
agcactcctcccactacgccctctccacggattccacgcagctgtcacttgctcagctcc
agtcacagcagccttgctcatcttccagctcctcctgttccaccaaggcagaattcaagc
cctctcttaccaaagctgccaccaaagacttacaaacgggagctttcccaccctccactg
tatagactgcctctgcttgaaaatgcagaaactcctcaatga

KEGG   Mus caroli (Ryukyu mouse): 110312423
Entry
110312423         CDS       T05910                                 

Gene name
Sos1
Definition
(RefSeq) son of sevenless homolog 1
  KO
K03099  son of sevenless
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04062  Chemokine signaling pathway
mcal04068  FoxO signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04540  Gap junction
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04714  Thermogenesis
mcal04722  Neurotrophin signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal04910  Insulin signaling pathway
mcal04912  GnRH signaling pathway
mcal04915  Estrogen signaling pathway
mcal04917  Prolactin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04935  Growth hormone synthesis, secretion and action
mcal05034  Alcoholism
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110312423 (Sos1)
   04012 ErbB signaling pathway
    110312423 (Sos1)
   04014 Ras signaling pathway
    110312423 (Sos1)
   04630 JAK-STAT signaling pathway
    110312423 (Sos1)
   04068 FoxO signaling pathway
    110312423 (Sos1)
   04072 Phospholipase D signaling pathway
    110312423 (Sos1)
   04151 PI3K-Akt signaling pathway
    110312423 (Sos1)
   04150 mTOR signaling pathway
    110312423 (Sos1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110312423 (Sos1)
   04540 Gap junction
    110312423 (Sos1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110312423 (Sos1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110312423 (Sos1)
   04660 T cell receptor signaling pathway
    110312423 (Sos1)
   04662 B cell receptor signaling pathway
    110312423 (Sos1)
   04664 Fc epsilon RI signaling pathway
    110312423 (Sos1)
   04062 Chemokine signaling pathway
    110312423 (Sos1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110312423 (Sos1)
   04912 GnRH signaling pathway
    110312423 (Sos1)
   04915 Estrogen signaling pathway
    110312423 (Sos1)
   04917 Prolactin signaling pathway
    110312423 (Sos1)
   04926 Relaxin signaling pathway
    110312423 (Sos1)
   04935 Growth hormone synthesis, secretion and action
    110312423 (Sos1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110312423 (Sos1)
  09159 Environmental adaptation
   04714 Thermogenesis
    110312423 (Sos1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110312423 (Sos1)
   05206 MicroRNAs in cancer
    110312423 (Sos1)
   05205 Proteoglycans in cancer
    110312423 (Sos1)
   05231 Choline metabolism in cancer
    110312423 (Sos1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110312423 (Sos1)
   05225 Hepatocellular carcinoma
    110312423 (Sos1)
   05226 Gastric cancer
    110312423 (Sos1)
   05214 Glioma
    110312423 (Sos1)
   05221 Acute myeloid leukemia
    110312423 (Sos1)
   05220 Chronic myeloid leukemia
    110312423 (Sos1)
   05211 Renal cell carcinoma
    110312423 (Sos1)
   05215 Prostate cancer
    110312423 (Sos1)
   05213 Endometrial cancer
    110312423 (Sos1)
   05224 Breast cancer
    110312423 (Sos1)
   05223 Non-small cell lung cancer
    110312423 (Sos1)
  09165 Substance dependence
   05034 Alcoholism
    110312423 (Sos1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110312423 (Sos1)
   05160 Hepatitis C
    110312423 (Sos1)
   05163 Human cytomegalovirus infection
    110312423 (Sos1)
   05165 Human papillomavirus infection
    110312423 (Sos1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110312423 (Sos1)
   01522 Endocrine resistance
    110312423 (Sos1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcal04990]
    110312423 (Sos1)
Domain-containing proteins not elsewhere classified [BR:mcal04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   110312423 (Sos1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 IQ_SEC7_PH PH_10 PH_13
Other DBs
NCBI-GeneID: 110312423
NCBI-ProteinID: XP_021041656
Ensembl: MGP_CAROLIEiJ_G0021908
UniProt: A0A6P5RC24
LinkDB
Position
17
AA seq 1319 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESNDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPAERIHHLLREVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITRQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSSN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHGHFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECMKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASSAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDGNSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTVLQEEKEEQMRLPSAEVYRFAEPDSEENILFEENVQPKAGIPI
IKAGTVLKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLRRHGKELINFSK
RRRVAEITGEIQQYQNQPYCLRVEPDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRH
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGTSSNTDVCSVFDSDHSASPFHSRSASVSSISLSKGTDEVPVPPPVP
PRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSISDRTSLSDPPESPPLL
PPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPPPQTPSPHGTRRHLP
SPPLTQEMDLHSIAGPPVPPRQSTSQLIPKLPPKTYKREHTHPSMHRDGPPLLENAHSS
NT seq 3960 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccttacgagtttttcagcgaggagaacgcgcccaagtggcgg
gggctgctggtgcctgcgctgaaaaaggttcaggggcaagttcaccctactcttgagtct
aatgatgatgctcttcagtatgttgaagaattaattttgcaattactaaatatgctatgc
caagctcagccccggagtgcttcagatgtggaggaacgtgttcaaaaaagttttcctcat
ccaattgataagtgggcaatagctgatgcccagtcagccattgaaaagaggaagagaaga
aatcctttatccctgccagcagaaagaattcatcatttattaagggaggtcctcggttat
aaaattgaccaccaggtttctgtttacatagtagcagtattagaatacatttctgcagat
attttaaagctggtggggaattatgtaagaaatatacggcattatgaaattacaagacaa
gacattaaagtggcaatgtgtgctgataaggtattgatggatatgtttcatcaagatgta
gaagatataaatatcttatctttaactgatgaagagccttccacctcaggagaacaaact
tattatgatttggtaaaagcattcatggcagaaattcgacagtatataagagaattaaat
ctaattataaaagtatttcgagaaccctttgtctctaattccaaattgttttcatctaat
gatgtagaaaacatatttagtcgtatagtagatatacatgaacttagtgtaaagttactg
ggccatatagaagatactgtagaaatgacagatgaaggcagtccccacccattagtagga
agctgttttgaagacttagcagaagaactggcatttgacccatatgagtcatatgctcgg
gatattttacgacctggattccatggccattttcttagtcagttatcaaagcctggggca
gcactttatttgcagtccataggcgaaggcttcaaagaagctgtccagtacgtcctgccc
cggctgctgcttgcccctgtgtaccactgtttgcattactttgaacttctgaagcagtta
gaagaaaagagtgaagatcaagaagacaaggagtgtatgaagcaagcaataacagccctg
cttaatgtccaaagtggcatggaaaaaatttgctccaaaagtcttgcaaaacgaagacta
agtgagtctgcatgtcggttttacagccagcagatgaaggggaaacaactggccatcaag
aagatgaacgagattcagaagaacatcgatggctgggaggggaaggacattggacagtgc
tgcaatgagttcataatggaaggaactcttacacgtgtaggagccaaacacgagagacac
atatttctcttcgatggcttaatgatttgctgtaaatcaaatcatgggcagccaagactc
cctggtgctagcagtgcagaatatcggcttaaagaaaagttttttatgcgaaaggtacag
attaatgataaagatgacaccagtgaatacaagcatgcttttgaaatcattctgaaagac
ggcaatagtgttatattttctgccaagtcagctgaagagaaaaacaactggatggcagcc
ctgatctctttgcagtaccgcagcaccctggagaggatgctggacgtaacggtgctgcag
gaggagaaggaggagcagatgaggctgcccagtgctgaagtgtacaggtttgcagaacct
gactccgaggagaatattctattcgaagagaatgtgcagcccaaagctgggatccccatt
atcaaagcagggactgtgctcaagctcattgagaggcttacataccatatgtacgcagat
ccaaattttgttcggacgtttcttacaacatacagatccttttgcaaacctcaagaacta
ctgagtcttctaatagaaagatttgaaattccagagcctgagccaacagaagctgatcgc
atagctatagagaatggagatcagcccctgagtgcagagctgaagaggtttagaaaggaa
tatatccagcctgtgcagttgagggtgttaaatgtgtgtcggcactgggtggagcaccat
ttctatgactttgaaagagatgcagaccttttacagagaatggaggaatttattggaaca
gtaagaggtaaagcaatgaaaaaatgggtcgaatccatcactaagataatccaaaggaaa
aaaattgcaagagacaatggcccaggtcataacattacatttcagagctcacctcccaca
gttgagtggcacataagcagacctgggcacatagagacttttgacttgctcaccttacac
ccaatagaaattgctcggcaactcactttacttgaatcagatctataccgagctgtgcag
ccatcagaattagttggaagtgtgtggacaaaagaagataaagaaattaattctcccaac
cttctgaagatgattcggcacaccactaacctcaccctgtggtttgagaaatgtattgta
gaaacagaaaacttagaagaaagagtagctgtagtgagtcgaataattgagattctacaa
gtctttcaagagctgaacaacttcaatggtgtcctggaagttgtcagtgctatgaactcg
tctcctgtttacagactagaccacacatttgagcaaataccaagtagacaaaagaaaatt
ttagaagaagctcatgagttgagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccgtgtgtgcctttctttggaatttatctcacaaatatcctgaagaca
gaagagggcaaccctgaggtcctgaggagacatgggaaagagcttattaacttcagcaag
aggaggagagtggccgagatcacaggcgagatccagcagtaccagaaccagccctactgc
ttacgggtggagccggacatcaagaggttctttgaaaacttgaatccaatgggaaatagc
atggagaaagaatttacagactatctattcaacaaatccttagaaatagaaccccggcac
cctaagcctcttccgagattcccaaaaaaatacagctatcccctaaaatctcctggtgtt
cgtccatcaaatccaagaccaggaaccatgagacatcccacacctctgcagcaggagcca
agaaaaattagctacagtcggattcctgaaagtgaaacggaaagcacagcatctgcacca
aactctccgcggaccccactgacgccgcctcccgcatctggcacgtccagcaacacagat
gtttgcagcgtgttcgattctgaccattcagcaagcccttttcattcaagatctgcttca
gtctcatctataagtttatccaagggcactgatgaagtgcctgttccccctcctgtaccc
cctcgaagacgtccagagtctgccccagctgaatcctccccatccaagattatgtctaag
cacttggacagccccccagctattcctcctaggcaacccacatccaaagcctattcacca
cgctattcaatatcagatcggacctctctatcagatcctcctgaaagccctcccttgtta
ccaccacgggaacctgtgaggacacctgatgttttctcaagctcgccattacatctccaa
cctcctcctttgggcaaaaagagtgatcatggcaatgccttcttcccaaacagcccatcc
ccttttacaccgccacccccccaaaccccttctcctcatggcacgagaaggcatctgcca
tcaccaccactgacacaggaaatggacctccattccattgctgggcctcctgttcctcca
cgacaaagcacttctcaacttatccccaaactccctccaaaaacttataaaagggagcac
acacacccatccatgcatagagatggaccaccactgctggagaatgcccattcttcctga

DBGET integrated database retrieval system