KEGG   Mus caroli (Ryukyu mouse): 110307768
Entry
110307768         CDS       T05910                                 

Gene name
Hnrnpk
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein K isoform X1
  KO
K12886  heterogeneous nuclear ribonucleoprotein K
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03040  Spliceosome
mcal05203  Viral carcinogenesis
mcal05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110307768 (Hnrnpk)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    110307768 (Hnrnpk)
   05203 Viral carcinogenesis
    110307768 (Hnrnpk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mcal03041]
    110307768 (Hnrnpk)
Spliceosome [BR:mcal03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    110307768 (Hnrnpk)
SSDB
Motif
Pfam: KH_1 ROKNT KH_2 KH_4 KH_5 MOEP19 DJ-1_PfpI
Other DBs
NCBI-GeneID: 110307768
NCBI-ProteinID: XP_021035633
Ensembl: MGP_CAROLIEiJ_G0018599
UniProt: A0A6P5R1C6
LinkDB
Position
13
AA seq 464 aa
METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGK
GGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTAT
SQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKL
FQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFT
MMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRG
GSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMA
YEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS
IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYADVEGF
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggagaccgaacagccagaagaaaccttccccaacaccgaaaccaatggtgaatttggt
aaacgccctgcagaagatatggaagaggagcaagcctttaaaagatctagaaatactgat
gagatggttgaattgcgcattttgcttcagagcaagaatgctggggcagtgattggaaaa
ggaggcaagaatattaaggctctccgtacagactacaatgccagtgtttcagtcccagac
agcagtggccccgagcgcatactgagtatcagtgctgatattgagacgattggagaaatt
ctgaagaaaatcatccctaccttggaagagggcctgcagttgccatcacccactgcaacc
agccagctcccgctcgaatctgatgctgtggaatgcttaaattaccaacattataaagga
agtgactttgattgcgagttgagactgttgattcatcagagtctggcaggaggaataatt
ggtgttaaaggtgctaaaatcaaagaacttcgagaaaacactcagacaacaatcaagctt
ttccaggagtgctgccctcactctactgacagagttgttcttattggaggaaaacctgat
agggttgtagaatgcatcaagatcatcctagaccttatatctgagtctcccatcaaagga
cgtgcacaaccttatgatcccaacttttatgatgagacctatgattatggtggttttaca
atgatgtttgatgaccgccgaggacgacctgtgggattccccatgaggggaagaggtggt
tttgacagaatgcctcctggtcggggtgggcgtcccatgcctccttctagaagagattat
gatgatatgagccctcgtcgaggacctcctccacctcctcctggtcgaggtggccggggt
ggcagcagagcccggaatcttcctcttcctcctccaccaccacccagagggggagatcta
atggcttatgacagaagaggaaggcctggagaccgctatgatggcatggttgggttcagt
gctgatgaaacttgggactctgcaattgacacatggagcccatcagaatggcaaatggct
tatgaaccacagggtggttctggatatgactattcttatgcagggggtcgtggctcatat
ggtgatcttggcggacctattatcactacacaagtaactattcccaaagatttggctgga
tctattattggcaaaggtggtcagcggattaaacaaattcgtcatgaatctggagcatca
atcaaaattgatgaacctttagaaggatctgaagatcggatcattaccattacaggaaca
caggaccagatacagaacgcacagtatttgctgcagaacagtgtgaagcagtatgcagat
gttgaaggattctaa

DBGET integrated database retrieval system