KEGG   Mus caroli (Ryukyu mouse): 110307775
Entry
110307775         CDS       T05910                                 

Gene name
Ptch1
Definition
(RefSeq) protein patched homolog 1
  KO
K06225  patched 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04024  cAMP signaling pathway
mcal04340  Hedgehog signaling pathway
mcal04360  Axon guidance
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110307775 (Ptch1)
   04024 cAMP signaling pathway
    110307775 (Ptch1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110307775 (Ptch1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110307775 (Ptch1)
   05205 Proteoglycans in cancer
    110307775 (Ptch1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110307775 (Ptch1)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 110307775
NCBI-ProteinID: XP_021035643
Ensembl: MGP_CAROLIEiJ_G0018634
LinkDB
Position
13
AA seq 1450 aa
MDLLNRNRLVIVSPRRTPPKACGGPARRGFYTFRSFCKDGGGGEDEDEDGGWGGEREGDR
ADKETRGDRGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKA
ANLETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQH
LDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEG
AKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLN
PADPDCPATAPNKNSTKPLDVALVLNGGCQGLSRKYMHWQEELIVGGTVKNATGKLVSAH
ALQTMFQLMTPKQMYEHFRGYDYVSHINWNEDRAAAILEAWQRTYVEVVHQSVAPNSTQK
VLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVA
LSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTG
ECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSM
DLYRREDRRLDIFCCFTSPCVSRVIQVEPQAYTEPHSNTRYSPPPPYTSHSFAHETHITM
QSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDNLSCQSPESTSSTRDLLSQFSDS
SLHCLEPPCTKWTFSSFAEKHYAPFLLKPKAKVVVILLFLGLLGVSLYGTTRVRDGLDLT
DIVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQRLLYDLHKSFSNVKYVMLEENK
QLPQMWLHYFRDWLQGLQDAFDSDWETGRIMPNNYKNGSDDGVLAYKLLVQTGSRDKPID
ISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPE
TRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRVICNNYTSLGLSSYPNGYPFLFW
EQYISLRHWLLLSISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKL
SAVPVVILIASVGIGVEFTVHVALAFLTAIGDKNHRAMLALEHMFAPVLDGAVSTLLGVL
MLAGSEFDFIVRYFFAVLAILTVLGVLNGLVLLPVLLSFFGPCPEVSPANGLNRLPTPSP
EPPPSVVRFAVPPGHTNNGSDSSDSEYSSQTTVSGISEELRQYEAQQGTGGPAHQVIVEA
TENPVFARSTVVHPDSRHQPPLNPRQQPHLDSGSLSPGRQGQQPRRDPPREGLRPPPYRP
RRDAFEISTEGHSGPSNRDRSGPRGARSHNPRNPTSTAMGSSVPSYCQPITTVTASASVT
VAVHPPPGPGRNPRGGPCPGYESYPETDHGVFEDPHVPFHVRCERRDSKVEVIELQDVEC
EERPWGSSSN
NT seq 4353 nt   +upstreamnt  +downstreamnt
atggacctgcttaatagaaacaggcttgtaattgtgagtccgcgccgcactccgccgaaa
gcctgcggcggccccgcgcgccggggtttttacactttccgttccttttgtaaagacgga
ggaggaggagaagacgaagacgaagacggggggtgggggggggaaagagaaggcgacagg
gcagacaaagagacccgcggcgacagggggaaggctactggccggaaagcgccgctgtgg
ctgagagcgaagtttcagagactcttatttaaactgggttgttacattcaaaagaactgc
ggcaagtttttggttgtgggtctcctcatatttggggccttcgctgtgggattaaaggca
gctaatctcgagaccaacgtggaggagctgtgggtggaagttggtggacgagtgagtcga
gaattaaattatacccgccagaagataggagaagaggctatgtttaatcctcaactcatg
atacagactccaaaagaagaaggcgctaatgttctgaccacagaggctctcctgcaacac
ctggactcagcactccaggccagtcgtgtgcacgtctacatgtataacaggcaatggaag
ttggaacatttgtgctacaaatcaggggaacttatcacggagacaggttacatggatcag
ataatagaatacctttacccttgcttaatcattacacctttggactgcttctgggaaggg
gcaaagctacagtccgggacagcatacctcctaggtaagcctcctttacggtggacaaac
tttgaccccttggaattcctagaagagttaaagaaaataaactaccaagtggacagctgg
gaggaaatgctgaataaagccgaagttggccatgggtacatggaccggccttgcctcaac
ccagccgacccagattgccctgccacagcccctaacaaaaattcaaccaaacctcttgat
gtggcccttgttttgaatggtggatgtcaaggtttatccaggaagtatatgcattggcag
gaggagttgattgtgggtggtaccgtcaagaatgccactggaaaacttgtcagcgctcac
gccctgcaaaccatgttccagttaatgactcccaagcaaatgtatgaacacttcaggggc
tacgactatgtctctcacatcaactggaatgaagacagggcagccgccatcctggaagcc
tggcagaggacttacgtggaggtggttcatcaaagtgtcgccccaaactccactcaaaaa
gtgctttccttcaccaccacgaccctggacgacatcctaaaatccttctccgatgtcagt
gtcatccgagtggccagtggctacctactgatgcttgcctatgcctgtttaaccatgctg
cgctgggactgctccaagtcccagggtgccgtggggctggctggcgtcctgttggttgcg
ctgtcagtggctgcaggattgggcctctgctccttgattggcatttcttttaatgctgcg
acaactcaggttttgccgtttcttgctcttggtgttggtgtggacgatgtcttcctcctg
gcccatgcattcagtgaaacaggacagaataagaggattccatttgaggacaggactggg
gagtgcctcaagcgcaccggagccagcgtggccctcacctccatcagcaatgtcaccgcc
ttcttcatggccgcattgatccctatccctgccctgcgagcgttctccctccaggctgct
gtggtggtggtattcaattttgctatggttctgctcatttttcctgcaattctcagcatg
gatttatacagacgtgaggacagaagattggatattttctgctgtttcacaagcccctgt
gtcagcagggtgattcaagttgagccacaggcctacacagagcctcacagtaacactcgg
tacagccccccacccccgtacaccagccacagcttcgcccacgaaacccatatcactatg
cagtccaccgttcagctccgcacagagtatgaccctcacacgcacgtgtactacaccacc
gccgagccacgctctgagatctctgtacagcctgtcaccgtcacccaggacaacctgagc
tgtcagagtcccgagagcaccagctccaccagggacctgctctcccagttctcagactcc
agcctccactgcctcgagcccccctgcaccaagtggacgttctcttcgtttgcagagaag
cactatgctcctttccttctgaaacccaaagccaaggttgtggtaatccttcttttcctg
ggcttgctgggggtcagcctttatgggaccacccgagtgagagacgggctggacctcacg
gacattgttccccgggaaaccagagaatatgacttcatagctgcccagttcaagtacttc
tctttctacaacatgtatatagtcacccagaaagcagactacccgaatatccagcgccta
ctttacgaccttcataagagtttcagcaatgtgaagtatgtcatgctggaggagaacaag
caacttccccaaatgtggctgcactactttagagactggcttcaaggacttcaggatgca
tttgacagtgactgggaaactgggaggatcatgccaaacaattataaaaatggatcagat
gacggggtcctcgcttacaaactcctggtgcagactggcagccgagacaagcccatcgac
attagtcagttgactaaacagcgtctggtggacgcagatggcatcattaatccgagcgct
ttctacatctacctgaccgcttgggtcagcaacgaccctgtagcttacgctgcctcccag
gccaacatccggcctcaccggccagagtgggtccatgacaaagccgactacatgccagag
accaggctgagaatcccagcagcagagcccatcgagtatgctcagttccctttctacctc
aacggcctacgagacacctcagactttgtggaagccatagaaaaagtgagagtcatctgt
aacaactatacgagcctgggattgtccagctaccccaatggctaccccttcctgttctgg
gagcaatacatcagcctgcgccactggctgctgctatccatcagcgtggtgctggcctgc
acgtttctagtgtgcgcagtcttcctcctgaacccctggacggccgggatcattgtcatg
gtcctggctctgatgaccgttgagctctttggcatgatgggcctcattgggattaagctg
agtgctgtgcctgtggtcatcctgattgcatctgttggcatcggagtggagttcaccgtc
cacgtggctttggcctttctgacagccattggggacaagaaccacagggctatgctcgct
ctggagcacatgttcgctcccgttctggacggtgctgtgtccactctgctgggtgtactg
atgcttgcagggtccgaatttgatttcattgtcagatacttctttgccgtcctggccatt
ctcaccgtcttgggggttctcaatggactggttctgctgcctgtcctcttatccttcttt
ggaccgtgtcctgaggtgtctccagccaatggcctaaaccgactgcccactccttcgcct
gagccgcccccaagtgtcgtccggttcgccgtgcctcctggtcacacgaacaatgggtct
gattcctctgactcggagtacagctctcagaccacagtgtctggcatcagtgaggagctc
aggcaatacgaggcacagcagggcaccggaggccctgcccaccaagtgattgtggaagcc
acagaaaaccctgtctttgcccggtccactgtggtccatccggactccagacatcagcct
cccttgaaccctcggcaacagccccacctggactctggctccttgtcccctggacgacaa
ggccagcagcctcgaagggatccccctagagaaggcttgcggccacccccctacagaccg
cgcagagacgcttttgaaatttctactgaagggcattctggccctagcaatagggaccgc
tcagggccccgcggggcccgttctcacaaccctcggaacccaacgtccaccgccatgggc
agctctgtgcccagctactgccagcccatcaccactgtgacggcttccgcttctgtgact
gtcgctgtgcatcccccacctggacctgggcgcaacccccgagggggaccctgtccaggc
tatgagagctaccctgagactgatcacggggtgtttgaggatccccatgtgccttttcat
gtcaggtgtgagaggagggactcaaaggtggaggtcatagagctacaggacgtggaatgt
gaggagaggccgtgggggagcagctccaactga

DBGET integrated database retrieval system