KEGG   Mus caroli (Ryukyu mouse): 110307946
Entry
110307946         CDS       T05910                                 

Gene name
Ripk1
Definition
(RefSeq) receptor-interacting serine/threonine-protein kinase 1
  KO
K02861  receptor-interacting serine/threonine-protein kinase 1 [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04064  NF-kappa B signaling pathway
mcal04210  Apoptosis
mcal04217  Necroptosis
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04668  TNF signaling pathway
mcal05132  Salmonella infection
mcal05160  Hepatitis C
mcal05163  Human cytomegalovirus infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110307946 (Ripk1)
   04668 TNF signaling pathway
    110307946 (Ripk1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110307946 (Ripk1)
   04217 Necroptosis
    110307946 (Ripk1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110307946 (Ripk1)
   04621 NOD-like receptor signaling pathway
    110307946 (Ripk1)
   04622 RIG-I-like receptor signaling pathway
    110307946 (Ripk1)
   04623 Cytosolic DNA-sensing pathway
    110307946 (Ripk1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110307946 (Ripk1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110307946 (Ripk1)
   05160 Hepatitis C
    110307946 (Ripk1)
   05163 Human cytomegalovirus infection
    110307946 (Ripk1)
   05169 Epstein-Barr virus infection
    110307946 (Ripk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110307946 (Ripk1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110307946 (Ripk1)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   110307946 (Ripk1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Death RHIM Kinase-like Pkinase_fungal Kdo RIO1
Other DBs
NCBI-GeneID: 110307946
NCBI-ProteinID: XP_021035910
Ensembl: MGP_CAROLIEiJ_G0018416
UniProt: A0A6P7QAD9
LinkDB
Position
13
AA seq 655 aa
MQPDMSLDNIKMASSDLLEKADLDSGGFGKVSLCYHRSHGFVILKKVYTGPNRTEYNEVL
LEEGKMMHRLRHSRVVKLLGIIIEEGNYSLVMEYMEKGNLMHVLKTQIDVPLSLKGRIIV
EAIEGMCYLHDKGVIHKDLKPENILVDRDFHIKIADLGVASFKTWSKLTKEKDNKQKEVS
SITKKNNGGTLYYMAPEHLNDINAKPTEKSDVYSFGIVLWAIFAKKEPYENVICTEQFVV
CIKSGNRPNVEEIIEYCPREIIGLMERCWQAIPEDRPTFLGIEEEFRPFYLSHFEEYVEE
DVASLKKEYPDQSPVLQRMFSLQHDCVPLPPSRSNSEQPGSLHSSQGFQMGPVEESWFSC
SPEYPQDENDRSVQAKLQEEASYHAFGIFAEKQTKPQPRQNEAYNREEERKRRVSHDPFA
QQRARENIKSAGARGHSDPSTSRGIAVQQQSWPATQAVWNNGLYNQHGFGTTGTGAWYPP
NLSQMYSTYKTPVPETNIPGSTPTMPYFSGPVADDLIKYTIFNSSGIQIGNHNYMDVGLN
SQPPNNTCKEESAARHQAIFDNTTSLTDEHLNPIRENLGRQWKNCARKLGFTESQIDEID
HDYERDGLKEKVYQMLQKWLMREGIKGATVGKLAQALHQCCRIDLLNHLIRASQS
NT seq 1968 nt   +upstreamnt  +downstreamnt
atgcaaccagacatgtccttggacaatattaagatggcctccagtgacctgctggagaag
gcagacctggacagtggaggcttcgggaaggtgtccttgtgttaccacagaagccatgga
tttgtcatcctgaaaaaagtatacacggggcccaaccgcactgagtacaatgaggttctc
ttggaagaggggaagatgatgcatagactgagacacagtcgagtggtgaagctactgggc
atcatcatagaagaagggaactattcgctggtgatggagtacatggagaagggcaacctg
atgcacgtgctaaagacccagatagatgtcccactttcattgaaaggaaggataatcgtg
gaggccatagaaggcatgtgctacttacatgacaaaggtgtgatacacaaggacctgaag
cctgagaatatcctcgttgatcgtgactttcacattaagatagccgatcttggtgtggct
tcctttaagacatggagcaaactgactaaggagaaagacaacaagcagaaagaagtgagc
agcatcactaagaagaacaatggaggtaccctctactacatggcacccgaacacctgaat
gacatcaatgcaaagcccacggagaagtcggacgtgtacagctttggcattgtcctttgg
gcaatatttgcaaaaaaggagccctatgagaatgtcatctgtactgagcagttcgtagtc
tgcataaaatctgggaacaggccaaatgtagaggaaatcattgagtactgtccaagggag
atcatcggcctcatggagcggtgctggcaggcgatcccagaagacaggccaacatttctt
ggcattgaagaagaatttaggcctttttacttaagtcattttgaagaatatgtagaagag
gatgtggcaagtttaaagaaagagtatccagatcaaagcccagttttgcagagaatgttt
tcactgcagcatgactgtgtacccttacctccgagcaggtcaaattcagaacaacctgga
tcactgcacagttcccagggattccagatgggtcctgtggaggagtcctggttttcttgc
tccccagagtacccacaggacgagaatgatcgcagtgtgcaggctaagctgcaagaggaa
gccagctatcatgcttttggaatatttgcagagaaacagacaaaaccacagccaaggcag
aatgaggcttacaacagagaggaggaaaggaaacgaagggtctctcatgacccctttgca
cagcagagagctcgtgagaatattaagagtgcaggagcaagaggtcattctgatcccagc
acaagtcgtggaattgcagtgcaacagcagtcatggccagccacccaagcagtttggaac
aatggattgtataatcagcatgggtttggaactacaggtacaggagcttggtatccgcca
aatctaagccaaatgtatagtacttataaaactccagtgccagagaccaacataccggga
agcacacccaccatgccatacttctctgggccagtagcagatgacctcataaaatatact
atattcaatagttctggtattcagattggaaaccacaattatatggatgttggactgaat
tcacaaccaccaaacaatacttgcaaagaagagtcggctgccagacaccaagccatcttt
gataacaccactagtctgactgatgaacacctgaaccctatcagggaaaacctgggaaga
cagtggaaaaactgtgcccgcaagctgggcttcactgagtctcagatcgatgaaattgac
catgactatgaaagagatggactgaaagagaaagtttaccaaatgcttcagaagtggctg
atgcgggaaggcatcaaaggggctacagtgggaaagttggcccaggcacttcaccaatgt
tgcaggatagacctgctgaaccacttgattcgtgccagccagagctaa

DBGET integrated database retrieval system