KEGG   Mus caroli (Ryukyu mouse): 110308282
Entry
110308282         CDS       T05910                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas isoform X1
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04024  cAMP signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04713  Circadian entrainment
mcal04714  Thermogenesis
mcal04724  Glutamatergic synapse
mcal04726  Serotonergic synapse
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04913  Ovarian steroidogenesis
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04921  Oxytocin signaling pathway
mcal04922  Glucagon signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04924  Renin secretion
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04961  Endocrine and other factor-regulated calcium reabsorption
mcal04962  Vasopressin-regulated water reabsorption
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal04976  Bile secretion
mcal05012  Parkinson disease
mcal05030  Cocaine addiction
mcal05031  Amphetamine addiction
mcal05032  Morphine addiction
mcal05034  Alcoholism
mcal05142  Chagas disease
mcal05146  Amoebiasis
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110308282
   04020 Calcium signaling pathway
    110308282
   04072 Phospholipase D signaling pathway
    110308282
   04024 cAMP signaling pathway
    110308282
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110308282
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110308282
  09152 Endocrine system
   04911 Insulin secretion
    110308282
   04922 Glucagon signaling pathway
    110308282
   04923 Regulation of lipolysis in adipocytes
    110308282
   04912 GnRH signaling pathway
    110308282
   04913 Ovarian steroidogenesis
    110308282
   04915 Estrogen signaling pathway
    110308282
   04921 Oxytocin signaling pathway
    110308282
   04926 Relaxin signaling pathway
    110308282
   04935 Growth hormone synthesis, secretion and action
    110308282
   04918 Thyroid hormone synthesis
    110308282
   04928 Parathyroid hormone synthesis, secretion and action
    110308282
   04916 Melanogenesis
    110308282
   04924 Renin secretion
    110308282
   04925 Aldosterone synthesis and secretion
    110308282
   04927 Cortisol synthesis and secretion
    110308282
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110308282
   04270 Vascular smooth muscle contraction
    110308282
  09154 Digestive system
   04970 Salivary secretion
    110308282
   04971 Gastric acid secretion
    110308282
   04972 Pancreatic secretion
    110308282
   04976 Bile secretion
    110308282
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110308282
   04961 Endocrine and other factor-regulated calcium reabsorption
    110308282
  09156 Nervous system
   04724 Glutamatergic synapse
    110308282
   04728 Dopaminergic synapse
    110308282
   04726 Serotonergic synapse
    110308282
   04730 Long-term depression
    110308282
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110308282
  09159 Environmental adaptation
   04713 Circadian entrainment
    110308282
   04714 Thermogenesis
    110308282
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110308282
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110308282
  09165 Substance dependence
   05030 Cocaine addiction
    110308282
   05031 Amphetamine addiction
    110308282
   05032 Morphine addiction
    110308282
   05034 Alcoholism
    110308282
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110308282
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110308282
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110308282
   05165 Human papillomavirus infection
    110308282
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110308282
   05142 Chagas disease
    110308282
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110308282
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110308282
   04031 GTP-binding proteins [BR:mcal04031]
    110308282
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110308282
  Exosomal proteins of other body fluids (saliva and urine)
   110308282
  Exosomal proteins of colorectal cancer cells
   110308282
  Exosomal proteins of bladder cancer cells
   110308282
GTP-binding proteins [BR:mcal04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    110308282
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc
Other DBs
NCBI-GeneID: 110308282
NCBI-ProteinID: XP_021036394
Ensembl: MGP_CAROLIEiJ_G0024756
UniProt: A0A6P5QQJ2
LinkDB
Position
2
AA seq 1134 aa
MGMFNCLHGNNMSGQHDIPPEVGEQPEQEPLEAPGAAAPGAGAGPAEEMATEPDSEPSNN
EPVPDETGSEISGPPEDSKSDIQSPCQAFEEVRVGGDYSPPPEEAMPFETQQPSLGAFWP
TLEQPGPSGTPSGLQAFNPAILEPGTPTGASPGLGAYTPPPEEAMPFEFNEPAQGDHSQP
PLQVPDLAPGGPEALAPRALPAEPGNIRFENAGFREDYSPPPEESVPFQVGGEEFGGDSP
PPGLPRVIPQIGIGGEFPTVAVPSALCLAPAENAPPLWVRGAIDRPFREAVRSPPNFACD
SPPMEITRPLLEIGRASIGVDDDTAVNMDSPPIARDGPPIEVSGAPDKSECAERPPVEQE
AAEMEGSPTTATAVEGKVPSPERGDGSSTQPEAMDAKPAPAAQAVSTGSDAGGAPDSAML
TDSQSDTGEDGTAPGTPSDLQSDPEELEEAPAVRADPDGGAAPVAPATPAESESEGSRDP
AAAEPASEAVPATTAESASGAAPVTQVEPAAAAVSATLAEPAARAVPITPTEPATRAVPS
ARAHPAAGAVPGAPAMSASARAAAARAAYAGPLVWGARSLSATPAARASLPARAAAAARA
ASAARAVAAGRSASAAPSRAHLRPPSPEIQVADPPTPRPPPRPTAWPDKYERGRSCCRYE
ASSGICEIESSSDESEEGATGCFQWLLRRNRRPGLPRSHTVGSNPVRNFFTRAFGSCFGL
SECTRSRSLSPGKAKDPMEERRKQMRKEAIEMREQKRADKKRSKLIDKQLEEEKMDYMCT
HRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLK
EAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPNFDFPPEFYEHAKALWEDEGVR
ACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFH
MFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNR
WLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYF
IRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NT seq 3405 nt   +upstreamnt  +downstreamnt
atgggcatgttcaactgcctccacggcaataatatgtcaggacaacacgatatcccccct
gaagtcggggagcagcccgagcaagaacctttggaagccccaggggcagctgcccccggt
gctggggctggcccagccgaagaaatggcaaccgaaccggactccgaaccgtctaacaat
gagcccgtccccgacgagactgggagtgagatcagtggacctccagaagactccaaatct
gacatccaaagcccctgccaggccttcgaggaagtccgagtgggtggagactacagccca
cctccggaggaagccatgccattcgagacacaacagcccagcctgggagctttctggccc
actctggagcagccaggaccatctgggaccccatcaggcctccaagccttcaacccagcg
attttggagcccgggacccccactggcgcgagcccaggcctgggagcctataccccccca
ccagaagaagctatgccatttgagttcaacgagcctgcccagggagaccatagccagcct
cccttgcaagtcccagaccttgctccaggaggtccggaagcattggcccccagagctctt
cccgcggagcccgggaacatcagatttgaaaacgctggcttccgagaagactacagccct
ccccctgaagaatctgtgccatttcaggtcggtggagaagaattcgggggcgatagccca
cccccaggactcccgcgagtcatcccacaaatcggcattggcggcgagttcccgacagtc
gcggtcccgagtgcgctctgcctcgctcccgccgagaacgcgcctcccctctgggtccga
ggcgccattgacagaccattccgcgaggctgtcagatctcctcctaacttcgcatgcgac
agccccccaatggagatcaccagacccctgcttgagattggcagagcctccattggggtc
gacgacgacaccgctgtcaatatggacagccccccaatcgcaagagatggcccgcccatc
gaagtctcgggagccccagataagagcgagtgcgcagagagacccccagttgagcaagaa
gcagccgagatggaaggaagccctaccaccgccactgcggtggaaggaaaagtcccctct
ccggagagaggggacggatcttccactcagcctgaagcaatggatgccaagccagcccct
gctgcccaagccgtctctaccggatctgatgctggaggagctccggattccgcgatgctc
acagatagccagagcgatacgggagaagacgggacagccccaggaacgccttcagatctc
cagtcggatcctgaagaactcgaagaagccccagctgtccgcgccgatcctgacggaggg
gcagccccagtcgccccagccactcctgccgagtccgagtctgaaggcagcagagatcca
gccgccgccgagccagcctccgaggcagtccctgccaccacggccgagtctgcctccggg
gcagcccctgtcacccaggtggagcccgcagccgcggcagtctctgccaccctggcggag
cctgccgcccgggcagtccccatcacccccacggagcccgctacccgggcagtcccctct
gctagagcccatccggccgctggagcagtccctggcgccccagcaatgtcagcctctgct
agggcagctgccgctagggcagcctatgcaggtccactggtctggggagccaggtcactc
tcagctactcccgccgctcgggcatcccttcctgcccgcgcagcagctgccgcccgggca
gcctctgctgcccgcgcagtcgctgctggccggtcagcctctgccgccccaagcagggcc
catcttagaccccccagccccgagatccaggttgctgacccgcctactccgcggcctcct
ccgcggccgactgcctggcctgacaagtacgagcggggccgaagctgctgcaggtacgag
gcatcgtctggcatctgcgagatcgagtcctccagtgatgagtcggaagaaggggccacc
ggctgcttccagtggcttctgcggcgaaaccgccgccctggcctgccccggagccacacg
gtcgggagcaacccagtccgcaacttcttcacccgagccttcggaagctgcttcggtcta
tccgagtgtacccgatcacgatccctcagccccgggaaggccaaggatcctatggaggag
aggcgcaaacagatgcgcaaagaagccattgagatgcgagagcagaagcgcgcagataag
aaacgcagcaagctcatcgacaagcaactggaggaggagaagatggactacatgtgtaca
caccgcctgctgcttctaggtgctggagagtctggcaaaagcaccattgtgaagcagatg
aggatcctgcatgttaatgggtttaacggagagggcggcgaagaggacccgcaggctgca
aggagcaacagcgatggtgagaaggccactaaagtgcaggacatcaaaaacaacctgaag
gaggccattgaaaccattgtggccgccatgagcaacctggtgccccctgtggagctggcc
aaccctgagaaccagttcagagtggactacattctgagcgtgatgaacgtgccgaacttt
gacttcccacctgaattctatgagcatgccaaggctctgtgggaggatgagggagtgcgt
gcctgctacgagcgctccaatgagtaccagctgattgactgtgcccagtacttcctggac
aagattgatgtgatcaagcaggccgactacgtgccaagtgaccaggacctgcttcgctgc
cgcgtcctgacctctggaatctttgagaccaagttccaggtggacaaagtcaacttccac
atgttcgatgtgggcggccagcgcgatgagcgccgcaagtggatccagtgcttcaatgat
gtgactgccatcatcttcgtggtggccagcagcagctacaacatggtcattcgggaggac
aaccagactaaccgcctgcaggaggctctgaacctcttcaagagcatctggaacaacaga
tggctgcgcaccatctctgtgattctcttcctcaacaagcaagacctgcttgctgagaaa
gtcctcgctgggaaatcgaagattgaggactactttccagagttcgctcgctacaccact
cctgaggatgcgactcccgagcccggagaggacccacgcgtgacccgggccaagtacttc
attcgggatgagtttctgagaatcagcactgctagtggagatgggcgccactactgctac
cctcactttacctgcgccgtggacactgagaacatccgccgtgtcttcaacgactgccgt
gacatcatccagcgcatgcatctccgccaatacgagctgctctaa

KEGG   Mus caroli (Ryukyu mouse): 110308334
Entry
110308334         CDS       T05910                                 

Definition
(RefSeq) neuroendocrine secretory protein 55
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04024  cAMP signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04713  Circadian entrainment
mcal04714  Thermogenesis
mcal04724  Glutamatergic synapse
mcal04726  Serotonergic synapse
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04913  Ovarian steroidogenesis
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04921  Oxytocin signaling pathway
mcal04922  Glucagon signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04924  Renin secretion
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04961  Endocrine and other factor-regulated calcium reabsorption
mcal04962  Vasopressin-regulated water reabsorption
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal04976  Bile secretion
mcal05012  Parkinson disease
mcal05030  Cocaine addiction
mcal05031  Amphetamine addiction
mcal05032  Morphine addiction
mcal05034  Alcoholism
mcal05142  Chagas disease
mcal05146  Amoebiasis
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110308334
   04020 Calcium signaling pathway
    110308334
   04072 Phospholipase D signaling pathway
    110308334
   04024 cAMP signaling pathway
    110308334
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110308334
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110308334
  09152 Endocrine system
   04911 Insulin secretion
    110308334
   04922 Glucagon signaling pathway
    110308334
   04923 Regulation of lipolysis in adipocytes
    110308334
   04912 GnRH signaling pathway
    110308334
   04913 Ovarian steroidogenesis
    110308334
   04915 Estrogen signaling pathway
    110308334
   04921 Oxytocin signaling pathway
    110308334
   04926 Relaxin signaling pathway
    110308334
   04935 Growth hormone synthesis, secretion and action
    110308334
   04918 Thyroid hormone synthesis
    110308334
   04928 Parathyroid hormone synthesis, secretion and action
    110308334
   04916 Melanogenesis
    110308334
   04924 Renin secretion
    110308334
   04925 Aldosterone synthesis and secretion
    110308334
   04927 Cortisol synthesis and secretion
    110308334
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110308334
   04270 Vascular smooth muscle contraction
    110308334
  09154 Digestive system
   04970 Salivary secretion
    110308334
   04971 Gastric acid secretion
    110308334
   04972 Pancreatic secretion
    110308334
   04976 Bile secretion
    110308334
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110308334
   04961 Endocrine and other factor-regulated calcium reabsorption
    110308334
  09156 Nervous system
   04724 Glutamatergic synapse
    110308334
   04728 Dopaminergic synapse
    110308334
   04726 Serotonergic synapse
    110308334
   04730 Long-term depression
    110308334
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110308334
  09159 Environmental adaptation
   04713 Circadian entrainment
    110308334
   04714 Thermogenesis
    110308334
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110308334
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110308334
  09165 Substance dependence
   05030 Cocaine addiction
    110308334
   05031 Amphetamine addiction
    110308334
   05032 Morphine addiction
    110308334
   05034 Alcoholism
    110308334
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110308334
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110308334
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110308334
   05165 Human papillomavirus infection
    110308334
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110308334
   05142 Chagas disease
    110308334
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110308334
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110308334
   04031 GTP-binding proteins [BR:mcal04031]
    110308334
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110308334
  Exosomal proteins of other body fluids (saliva and urine)
   110308334
  Exosomal proteins of colorectal cancer cells
   110308334
  Exosomal proteins of bladder cancer cells
   110308334
GTP-binding proteins [BR:mcal04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    110308334
SSDB
Motif
Pfam: NESP55 MARVEL
Other DBs
NCBI-GeneID: 110308334
NCBI-ProteinID: XP_021036461
Ensembl: MGP_CAROLIEiJ_G0024756
LinkDB
Position
2
AA seq 248 aa
MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALASSNARAQQRAAQRR
SFLNAHHRSAAAAAAAQVLPESSESESDHEHEEAEPELARPECLEYDQDDYETETDSETE
PETDIESETEIETEPETEPETEPEDERGPRGATFNQSLTQRLHALKLQSADASPRRAQPT
TQEPESASEWEESQRGPLDQDPRDPEESEERKEENRQPRRCKTKRPARRRDQSPESPPRK
GPIPIRRH
NT seq 747 nt   +upstreamnt  +downstreamnt
atggatcgcaggtcccgggctcagcagtggcgccgagctcgccataattacaacgacttg
tgcccgcccataggccgccgggcagccaccgctctcctctggctctcctgctccattgct
ctcctccgcgccctagcctcttccaacgcccgcgcccagcagcgtgctgcccagcgccgg
agcttccttaacgcccaccaccgctccgctgccgctgcagctgctgcacaggtactcccc
gagtcctctgaatccgagtctgatcacgagcacgaggaggctgagcctgagctggcccgc
cccgagtgcctagagtacgatcaggacgactacgagaccgagaccgattctgagaccgag
cctgagactgatatcgaatccgagaccgaaatcgagaccgagccagaaaccgagccagag
accgagccagaggacgagcgcggcccccggggcgccaccttcaaccagtcactcactcag
cgtctgcacgctctgaagttgcagagcgccgacgcctccccgagacgtgcgcagcccacc
actcaggagcctgagagcgcaagcgagtgggaggagtcccagcgagggcccttagatcag
gatccccgggaccccgaggagtcagaggagcgcaaggaggagaacaggcagccccgccgc
tgcaagaccaagaggccagcccgccgtcgcgaccagtccccggagtcccctcccagaaag
gggcccatccccatccggcgtcactaa

DBGET integrated database retrieval system