KEGG   Mus caroli (Ryukyu mouse): 110308360Help
Entry
110308360         CDS       T05910                                 

Gene name
Htr1a
Definition
(RefSeq) 5-hydroxytryptamine receptor 1A
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04024  cAMP signaling pathway
mcal04080  Neuroactive ligand-receptor interaction
mcal04726  Serotonergic synapse
mcal04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    110308360 (Htr1a)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110308360 (Htr1a)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    110308360 (Htr1a)
  09157 Sensory system
   04742 Taste transduction
    110308360 (Htr1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcal04030]
    110308360 (Htr1a)
G protein-coupled receptors [BR:mcal04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    110308360 (Htr1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 110308360
NCBI-ProteinID: XP_021036488
Ensembl: MGP_CAROLIEiJ_G0018870
LinkDB All DBs
Position
13
AA seq 422 aa AA seqDB search
MDMFSLDQGNNTTTSQEPFGTGGNDTGLSNVTFGYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKKGAGT
SFGTSSAPPPKKSLNGQPGSGDCRRSAENRAVGTPCANGAVRQGEDDATLEVIEVHRVGN
SKGHLPLPSESGATSYVPACLERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPELLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatatgttcagtcttgaccagggcaacaacaccacaacgtcccaggagcccttcggg
acaggcggcaatgatactggcctctccaatgtgaccttcggctaccaagtgatcacctct
cttttgctggggacgctcattttctgcgcggtgctcggcaatgcctgcgtggttgctgcc
atcgccctggagcgctcccttcagaatgttgccaactatctcatcggctccttggcggtc
accgatctcatggtgtcagtgctggtgctgcccatggctgctctgtaccaggtgctcaac
aagtggaccctgggtcaggtcacctgtgacctgtttatcgccctggatgtgctgtgctgc
acttcgtccatcctgcacctgtgcgccatcgcgctagacaggtactgggcaatcaccgac
cctatagactacgtgaacaagaggacgccccggcgcgccgctgcgctgatctcgctcact
tggctcattggctttctcatctccatcccgcctatgctgggctggcgcaccccggaagac
cgctcgaaccccaacgagtgcaccatcagcaaggatcatgggtacaccatctactccact
ttcggcgctttctatattccgctgctgctcatgctggtcctctatgggcgcatcttcaga
gccgcgcgcttccgaatccgcaagacggtcaagaaggtggaaaagaagggagcaggcacc
agcttcggaacttcgtcggccccgccccccaagaagagcctgaatggtcagccaggtagt
ggggactgcaggcgcagtgctgagaacagggcggtggggactccgtgcgctaacggggcg
gtgagacagggcgaggacgacgccaccctggaggtgatcgaggtgcatcgagtgggcaac
tccaaagggcaccttcctctgcccagcgaatcaggagctacctcctatgtccccgcctgc
ttggagagaaaaaatgagcgcaatgctgaggcaaagcgcaagatggccttggcccgtgag
aggaagacagtgaagacactgggcatcatcatgggcaccttcatcctctgctggctgccc
tttttcattgtggccctggtcctgcctttctgtgagagcagttgccacatgcctgagttg
ttgggtgccataattaactggctaggctactccaactccctgctcaacccagttatttat
gcttatttcaacaaagactttcaaaacgcttttaagaaaatcatcaagtgcaagttctgc
cgccgatga

DBGET integrated database retrieval system