KEGG   Mus caroli (Ryukyu mouse): 110308520
Entry
110308520         CDS       T05910                                 

Gene name
Polk
Definition
(RefSeq) DNA polymerase kappa isoform X1
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03460  Fanconi anemia pathway
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05216  Thyroid cancer
mcal05217  Basal cell carcinoma
mcal05218  Melanoma
mcal05220  Chronic myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    110308520 (Polk)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110308520 (Polk)
   05202 Transcriptional misregulation in cancer
    110308520 (Polk)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110308520 (Polk)
   05212 Pancreatic cancer
    110308520 (Polk)
   05225 Hepatocellular carcinoma
    110308520 (Polk)
   05226 Gastric cancer
    110308520 (Polk)
   05214 Glioma
    110308520 (Polk)
   05216 Thyroid cancer
    110308520 (Polk)
   05220 Chronic myeloid leukemia
    110308520 (Polk)
   05217 Basal cell carcinoma
    110308520 (Polk)
   05218 Melanoma
    110308520 (Polk)
   05213 Endometrial cancer
    110308520 (Polk)
   05224 Breast cancer
    110308520 (Polk)
   05222 Small cell lung cancer
    110308520 (Polk)
   05223 Non-small cell lung cancer
    110308520 (Polk)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110308520 (Polk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110308520 (Polk)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     110308520 (Polk)
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    110308520 (Polk)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone zf-C2H2_12
Other DBs
NCBI-GeneID: 110308520
NCBI-ProteinID: XP_021036618
Ensembl: MGP_CAROLIEiJ_G0018805
UniProt: A0A6P5QXS3
LinkDB
Position
13
AA seq 853 aa
MDNTKEKDNNFKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSKFYGNELKKEKQV
NQRIENMMQQKAQITSQQLRKARLQVDRFAMELERNRNLNNTIVHVDMDAFYAAVEMRDN
PELKDKPIAVGSMSMLATSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKE
VKEILAEYDPNFMAVSLDEAYLNITQHLQERRDWPEDKRRYFIKMGNYLEIDTPRQEANE
LTEYERSISPLLFEDSPPDLQPQGSPFQLNSEEQNSPQIAQNPVVFGTSAEEVVKEIRFR
IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPSRSSVMDFIKDLPIRKVSGIGKV
TEKMLMALGIATCTELYQQRALLSLLFSETSWHYFLHIALGLGSTDLARDGERKSMSVER
TFSEISKTEEQYSLCQELCAELAHDLQKEGLKGRTVTIKLKNVNFEVKTRASTVPAAIST
AEEIFAIAKELLRTEVNVGSPHPLRLRLMGVRMSTFSSEDDRKHQQRSIIGFLQAGNQAL
SSTGDSLDKTDKTELAQPLEMSHTKSFFDKKRSERISNCQDTSRCKTAGQQALQILEPSQ
ALKKLSESFETSENSNDCQTFICPVCFREQEGVSLEAFNEHVDECLDGPSTSENSKISCY
SHASSADIGQKEDVHPSIPLGEKRRHENGEITSVDGVDLTGMEDRSLKAASMDTLENNRS
KEEYPDIPDKSCPISLANETISALSRQESIQPCTDEVVTGQALVCPVCNLEQETSDLTLF
NIHVDICLNKGIIQELRNSEGNSVKQPKESSRSTDRLQKASGRTKRPGMKTKSSTSKKTK
PRDPRHTLDGFFK
NT seq 2562 nt   +upstreamnt  +downstreamnt
atggataacacaaaggaaaaggacaacaacttcaaagacgacctcctgctccgcatggga
ctaaacgataacaaggcaggcatggaagggttggataaggagaaaattaacaaaattatc
atggaagccacaaaggggtccaaattttatggaaatgagctcaagaaggaaaagcaagtc
aatcaacgaattgaaaatatgatgcaacaaaaagctcaaattaccagccagcagctaagg
aaagctcgattgcaggttgacagatttgcaatggagttagaacggaaccggaatttgaac
aataccatcgttcatgttgacatggatgctttctatgcagctgtcgaaatgagggacaac
ccggagctgaaggataaacccattgctgtaggatccatgagcatgttggctacttcaaat
taccatgcaaggaggtttggtgtccgtgcagccatgccaggatttattgctaagaggctc
tgcccacaacttattatagtgcccccaaactttgacaaatatagagctgtgagtaaggag
gttaaggagatactggctgaatatgatcccaattttatggctgtgagtctggacgaagcc
tacttgaatataacacagcacttgcaggaaaggcgagattggcctgaggacaaaaggaga
tatttcatcaaaatggggaactacttagaaatcgacacacccagacaggaagctaacgag
ctgactgagtatgagcggtccatctccccgctgctttttgaagatagtcctcctgatttg
caaccccaaggaagtcctttccaactgaactctgaagaacaaaacagtcctcaaatagcc
caaaatccagttgtttttggaacatcagctgaggaagtggtaaaggaaattcgcttcaga
attgaacaaaaaacaacgctgacagccagcgcaggcatcgcccccaatacaatgttagca
aaagtgtgcagtgataagaataagccgaacggacagtaccagatccttcccagcaggagc
tcggtgatggacttcatcaaggacctgcctattagaaaggtttctggaataggaaaagtt
acagagaaaatgttaatggctctcgggattgctacttgcacggaactctaccaacagaga
gcgttgctgtctctccttttctctgaaacatcttggcattattttcttcacatcgcactg
ggtctaggttcaacagacctggcaagggatggagaaaggaaaagcatgagtgttgaaagg
acattcagtgagataagtaagacagaggaacagtacagcctgtgccaagaactgtgcgct
gagctcgcccacgacctccagaaggaaggacttaagggaagaactgttaccattaagctg
aagaacgtgaattttgaagtaaaaactcgtgcatctacagttccggccgccatttctact
gcagaggaaatatttgccattgccaaggagctgctaaggacagaagttaatgtgggttcg
ccacaccccctgcggttaagactgatgggtgtccgaatgtctactttttccagtgaagat
gacaggaaacaccaacaaaggagcatcattggtttcttacaagctggaaaccaagctttg
tcatctactggggatagtctagacaaaactgacaaaactgagcttgcacagcccttagaa
atgtctcatacgaagagtttctttgataaaaagcgatcagaaagaatttccaactgtcaa
gacacatccagatgtaaaactgcgggtcagcaagctttacagatcttggaaccatcccaa
gcattaaagaagctgagcgagagttttgaaacatcagagaattcaaatgactgtcagaca
tttatatgtccagtttgctttagggagcaagaaggtgtcagtctggaagcctttaatgaa
catgtagatgagtgtcttgatggaccgtcaaccagtgagaactcaaaaatatcctgttac
tcacatgcttcctctgcagacattggtcagaaggaagatgtacacccctctattccactg
ggtgagaaacggaggcatgaaaatggagagatcacttcagtagatggtgtagatctaaca
gggatggaagacagatcattgaaagcagcaagtatggacactctagagaataatcgcagc
aaagaggaatatcctgatattccagacaagtcttgtcctatatcactggcaaatgaaacc
atcagtgcattaagtaggcaagaatctatccagccttgtacagatgaggtagtaacagga
caagctctagtgtgtcctgtttgtaacctagaacaagagacttctgatcttaccctcttc
aacatacatgtggatatttgcttaaataaaggtattatccaagaactgagaaatagtgaa
ggtaattcagttaaacaacccaaagaaagctcgagaagtactgacagacttcagaaggct
tcaggaaggaccaaaaggccaggaatgaagacaaagagctcaacatcgaagaaaacaaag
ccccgagatcccagacacacccttgatggattttttaaatga

DBGET integrated database retrieval system