KEGG   Mus caroli (Ryukyu mouse): 110309049
Entry
110309049         CDS       T05910                                 

Gene name
Irf9
Definition
(RefSeq) LOW QUALITY PROTEIN: interferon regulatory factor 9
  KO
K04693  interferon regulatory factor 9
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04217  Necroptosis
mcal04380  Osteoclast differentiation
mcal04621  NOD-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04630  JAK-STAT signaling pathway
mcal05160  Hepatitis C
mcal05162  Measles
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05171  Coronavirus disease - COVID-19
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110309049 (Irf9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110309049 (Irf9)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110309049 (Irf9)
   04625 C-type lectin receptor signaling pathway
    110309049 (Irf9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110309049 (Irf9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110309049 (Irf9)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110309049 (Irf9)
   05171 Coronavirus disease - COVID-19
    110309049 (Irf9)
   05164 Influenza A
    110309049 (Irf9)
   05162 Measles
    110309049 (Irf9)
   05168 Herpes simplex virus 1 infection
    110309049 (Irf9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110309049 (Irf9)
   05169 Epstein-Barr virus infection
    110309049 (Irf9)
   05165 Human papillomavirus infection
    110309049 (Irf9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110309049 (Irf9)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    110309049 (Irf9)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 110309049
NCBI-ProteinID: XP_021037072
Ensembl: MGP_CAROLIEiJ_G0019303
UniProt: A0A6P5QS26
LinkDB
Position
14
AA seq 463 aa
MHLPGGELKLRVGTVERGGEIRKSLEPAEPGTSSAAQALPTSSAPPLPPAAAPPTPLAKR
GLVRRRMASGKVRCTRKLRSWIVQQVESGHFPGVCWDDADKTMFRIPWKHAGKQDFREDQ
DAAIFKAWALFKEKHKDGDIGHPAVWKTRLRCALNKSSEFEEVPERGRMDVAEPYKVYRI
LPAGTPPNQPRNQKSPCKRSISCVSPEREENTENGRTNGVVNHSDSGSNIGGGGNGSNRS
DSNSNSELEEGAGTTEATIREDPVFLEHQLPLNSDYSLLLTFIYGGRVVGKTQVHSLDCR
LVAERSDSESSMEQVEFPKPDPLEPTQRLLSQLERGVLVASNSRGLFVQRLCPIPISWNA
PEAPPGPGPHLLPSNKCVELFKTTYFCRDLAQYFQGQGPPPKFQATLHFWEESPGSSHSQ
ENLITVQMEQAFARHLLEKIPEEEKAALFLLHHTEQSPSALGL
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgcacctccccggaggagaactgaaacttagggtggggactgtagaaaggggaggagag
atcagaaaaagcctagaaccagctgagcctgggacctcctcagcggctcaggccctgccc
acttcttcagctccgcccttgcccccagctgccgccccacctacccctctagcaaagagg
ggtttggtaaggagaaggatggcctcaggcaaagtacgctgcacccgaaagctgcggagc
tggatcgtgcagcaggtggagagtggccatttcccaggggtgtgctgggacgatgcagac
aagaccatgttccggatcccctggaagcacgcgggcaagcaagacttccgagaggaccag
gatgctgccatattcaaggcttgggcactgtttaaggaaaagcacaaagatggggacata
ggacacccggctgtctggaagactcgcctacgctgtgccctcaacaagagttctgaattt
gaagaggttcctgagagaggtcgtatggatgttgctgaaccctacaaagtatatcgaata
ctgccagcaggaaccccccctaaccaaccacggaaccagaaatcaccatgcaagcgaagt
atcagttgtgtgtcacctgagagggaagaaaatacggaaaatgggaggaccaatggagtt
gtaaaccactcagacagtggcagcaacataggcggtggtggcaatggcagcaacaggagc
gacagcaacagcaactctgagctagaggagggagctggcacaactgaggccaccattaga
gaggacccagtgttcctggagcatcaacttcctctgaactcagactattcgctgctgctc
accttcatctatggtggccgagtggtgggtaagacccaggtgcacagcctagactgtcgg
ctcgtggctgagcgctcagactcagagagcagcatggagcaggtggagtttcccaaaccc
gacccactggagcctacccagcgcctgctgagtcagcttgagagaggcgtcctggtggcc
agcaattccagaggcctctttgttcagcgcctttgccccatccccatctcctggaacgca
cccgaggccccacccgggcctggtcctcatctgctgcccagcaataagtgtgtggagctc
ttcaagaccacctacttctgtagagatttggcccagtacttccagggccagggcccccca
cccaagttccaagcaaccctacatttctgggaggagagtcctggctctagccatagccaa
gagaatctcatcacagtgcagatggagcaggcctttgcccgacatttactggagaagatt
ccagaggaggaaaaagctgccttgttcctgttacaccacacagagcagtcaccctctgct
ctcggtctctga

DBGET integrated database retrieval system