KEGG   Mus caroli (Ryukyu mouse): 110309154
Entry
110309154         CDS       T05910                                 

Gene name
Prkcd
Definition
(RefSeq) protein kinase C delta type isoform X1
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04062  Chemokine signaling pathway
mcal04140  Autophagy - animal
mcal04270  Vascular smooth muscle contraction
mcal04621  NOD-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04722  Neurotrophin signaling pathway
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04912  GnRH signaling pathway
mcal04915  Estrogen signaling pathway
mcal04930  Type II diabetes mellitus
mcal04931  Insulin resistance
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05020  Prion disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110309154 (Prkcd)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110309154 (Prkcd)
   04625 C-type lectin receptor signaling pathway
    110309154 (Prkcd)
   04666 Fc gamma R-mediated phagocytosis
    110309154 (Prkcd)
   04062 Chemokine signaling pathway
    110309154 (Prkcd)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110309154 (Prkcd)
   04915 Estrogen signaling pathway
    110309154 (Prkcd)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110309154 (Prkcd)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110309154 (Prkcd)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110309154 (Prkcd)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    110309154 (Prkcd)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110309154 (Prkcd)
   04931 Insulin resistance
    110309154 (Prkcd)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110309154 (Prkcd)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110309154 (Prkcd)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     110309154 (Prkcd)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   110309154 (Prkcd)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C C1_2 zf-RING-like Zf_RING Kinase-like zf-RING_9 PHD DUF2318 Pkinase_fungal DZR APH CxC3
Other DBs
NCBI-GeneID: 110309154
NCBI-ProteinID: XP_021037269
Ensembl: MGP_CAROLIEiJ_G0019052
LinkDB
Position
14
AA seq 701 aa
MAPFLRISFNSYELGSLQVEDEASQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKTTFD
AHIYEGRVIQIVLMRAAEDPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMCVQY
FLEDGDCKQSMRSEEEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRSSR
RLDTTESVGIYQGFEKKPEVSESDSLGEAGSHIPLKLSFPNRAKEKDSSETCADNNGTYG
KIWEGSTRCTLENFTFQKVLGKGSFGKVLLAELKGKDKYFAVKCLKKDVVLIDDDVECTM
VEKRVLALAWENPFLTHLICTFQTKEHLFFVMEFLNGGDLMFHIQDKGRFELYRATFYAA
EIICGLQFLHSKGIIYRDLKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYI
APEILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKES
KDIMEKLFERDPDKRLGVTGNIRIHPFFKTINWSLLEKRKVEPPFKPKVKSPSDYSNFDP
EFLNEKPQLSFSDKNLIDSMDQAAFHGFSFVNPKFEQYLDI
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggcacccttcctgcgcatctccttcaattcctatgagctgggctccctgcaagttgag
gacgaagcaagccagcctttctgtgctgtgaagatgaaggaggcactcagcacagagcga
gggaagacactggtacagaagaagcccaccatgtatcctgagtggaagacaacgttcgac
gcccacatctatgaaggccgtgttatccagattgtgctgatgcgggcagctgaagacccc
gtgtctgaggtcacggtgggagtgtcagtactggctgagcgctgcaagaagaacaacggc
aaggctgagttctggctggatctgcagcctcaggccaaggtgctgatgtgtgtgcagtat
ttcctggaggatggggattgcaaacagtccatgcgtagtgaggaggaggcaaagtttcca
accatgaaccgccgtggagccattaaacaggccaagatccactacatcaagaaccacgag
tttatcgccaccttcttcgggcagcccaccttctgttctgtgtgcaaagagtttgtctgg
ggcctcaacaagcaaggctacaaatgcaggcaatgcaacgctgccatccacaagaaatgc
attgacaagattatcggccgctgcactggcactgccaccaatagccgggacaccatcttc
cagaaagaacgcttcaacatcgacatgcctcaccgattcaaggtttataactacatgagc
cccaccttctgtgaccactgtggcagtttgctctggggactggtgaagcagggattaaag
tgtgaagattgtggcatgaatgtgcaccacaaatgccgggagaaggtggccaacctgtgt
ggtatcaaccaaaagctcttggctgaggccttaaaccaagtaacccagagatcttcccgg
aggctggacacaacagagtctgtcggaatataccagggatttgagaagaagccagaagtc
tctgagagtgacagcctaggtgaagctgggtcacatatccctttaaagctatcattcccc
aacagggcaaaggaaaaggacagtagtgagacctgcgcagacaacaacgggacctatggc
aagatctgggaggggagcacccggtgcacccttgagaacttcaccttccaaaaagtactg
ggcaaaggcagctttggcaaggtgctgctggcagagctgaagggcaaagacaagtacttt
gcagtcaagtgtctgaagaaggacgtggtgctgattgacgacgatgtagagtgtaccatg
gtggagaagcgggtgctggcgctcgcctgggagaatcccttcctcacccacctcatctgt
accttccagaccaaggagcacctgttcttcgtgatggagtttctcaatggtggggatctg
atgttccacattcaggacaaaggccgcttcgaactctaccgggctacgttttatgcagct
gagatcatctgcggactgcagtttctacacagcaaaggcattatttacagggacctcaag
ctggacaatgtgatgctagacagggacggccacatcaagattgctgactttgggatgtgc
aaagagaatatatttggggagggccgggccagcacattctgcggcactcctgactacatc
gcccctgagatcctgcagggcctgaagtactccttctccgtggactggtggtctttcggg
gtcctcctgtatgaaatgctcatcggccagtcccccttccacggcgatgatgaggacgag
ctcttcgagtccatccgggtggacacaccacactatccccgttggatcaccaaggaatcc
aaggacatcatggagaagctattcgagagggaccctgacaagaggctgggagtaacagga
aacatcaggattcacccctttttcaagactatcaactggtccctcctggagaagcggaag
gtggagccgccctttaagcccaaagtgaaatccccgtcagactacagcaacttcgacccg
gagttcctcaatgagaagcctcagctttccttcagtgacaagaacctcatcgactctatg
gaccaggcagccttccacggcttctcctttgtgaatcccaagtttgagcaatacctggac
atttga

KEGG   Mus caroli (Ryukyu mouse): 110312510
Entry
110312510         CDS       T05910                                 

Gene name
Prkce
Definition
(RefSeq) protein kinase C epsilon type
  KO
K18050  novel protein kinase C epsilon type [EC:2.7.11.13]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04022  cGMP-PKG signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04270  Vascular smooth muscle contraction
mcal04371  Apelin signaling pathway
mcal04530  Tight junction
mcal04666  Fc gamma R-mediated phagocytosis
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04925  Aldosterone synthesis and secretion
mcal04930  Type II diabetes mellitus
mcal04931  Insulin resistance
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110312510 (Prkce)
   04071 Sphingolipid signaling pathway
    110312510 (Prkce)
   04022 cGMP-PKG signaling pathway
    110312510 (Prkce)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110312510 (Prkce)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    110312510 (Prkce)
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    110312510 (Prkce)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110312510 (Prkce)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110312510 (Prkce)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    110312510 (Prkce)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110312510 (Prkce)
   04931 Insulin resistance
    110312510 (Prkce)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110312510 (Prkce)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110312510 (Prkce)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     110312510 (Prkce)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   110312510 (Prkce)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C FTA2 Kinase-like Kdo PP_M1
Other DBs
NCBI-GeneID: 110312510
NCBI-ProteinID: XP_021041824
Ensembl: MGP_CAROLIEiJ_G0021935
UniProt: A0A6P5R975
LinkDB
Position
17
AA seq 737 aa
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKT
NSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLE
PEGKVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQP
TYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDEVGSQRFSVN
MPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
KVLADLGVTPDKITNSGQRRKKLAAGAESPQPASGNSPSEDDRSKSAPTSPCDQELKELE
NNIRKALSFDNRGEEHRASSATDGQLASPGENGEVRPGQAKRLGLDEFNFIKVLGKGSFG
KVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKD
RLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILL
DAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
MAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVAAQNGED
AIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPILTLVDEAIIKQI
NQEEFKGFSYFGEDLMP
NT seq 2214 nt   +upstreamnt  +downstreamnt
atggtagtgttcaatggccttcttaagatcaaaatctgcgaggccgtgagcttgaagccc
acagcctggtcgctgcgccatgcggtgggaccccggccacagacgttccttttggacccc
tacattgcccttaacgtggacgactcgcgcatcggccaaacagccaccaagcagaagacc
aacagcccggcctggcacgatgagttcgtcaccgatgtgtgcaatgggcgcaagatcgag
ctggctgtctttcacgacgctcctatcggctacgacgacttcgtggccaactgcaccatc
cagttcgaggagctgctgcagaatgggagccgtcacttcgaggactggattgacctggag
ccagaaggaaaagtgtacgtgatcatcgatctctcgggatcatcgggtgaagcccccaaa
gacaatgaagaacgagtgttcagggagcgtatgcggccaaggaagaggcaaggggctgtc
aggcgcagggtccaccaggtcaatggccacaagttcatggccacctacttacggcaaccc
acctactgctcccactgcagagatttcatctggggtgtcataggaaaacaggggtatcaa
tgtcaagtttgcacttgcgttgtccacaagcgatgtcatgagctcattattacaaagtgc
gctgggctgaagaaacaggaaacccctgacgaggtgggctcccaacggttcagcgtcaat
atgccccacaagttcgggatccacaactacaaggtccccacgttctgtgaccactgtggg
tccctgctctggggcctcttgcggcagggcttgcagtgtaaagtctgcaaaatgaatgtt
caccggcgatgtgagaccaacgtggctcccaactgtggggtagacgccagaggaattgcc
aaagtgctggctgacctcggtgttactccagacaaaatcaccaacagtggccaaaggagg
aaaaagctcgctgctggtgctgagtccccacagcctgcttctggaaactccccatctgaa
gacgaccgatccaagtcagcgcccacctccccttgtgaccaggaactaaaagaacttgaa
aacaacatccggaaggccttgtcatttgacaaccgaggagaggagcaccgagcgtcgtcg
gccaccgatggccagctggcaagccccggggagaacggggaagtccggccaggccaggcc
aagcgcttggggctggatgagttcaacttcatcaaggtgttgggcaaaggcagctttggc
aaggtcatgttggcggaactcaaaggcaaagatgaagtctacgctgtgaaggtcttgaag
aaggacgttatcctacaagacgatgatgtggactgcacaatgacagagaagaggattttg
gctctggctcggaaacacccttatctaacccaactctattgctgcttccagaccaaggac
cgcctcttcttcgtcatggaatatgtaaatggtggagacctcatgttccagattcagcgg
tcccgaaaatttgatgagcctcgttctcggttctatgccgcagaggtcacatcggccctc
atgtttctccaccagcacggagtgatctacagggatttgaaactggacaacatccttcta
gacgcagaaggccactgcaagctggctgactttgggatgtgcaaggaagggattctgaat
ggcgtgacaaccaccaccttctgtgggactcctgactacatagctccagagatcctacag
gagttggagtacggcccctcagtggactggtgggccctgggagtgctgatgtacgagatg
atggctgggcagcccccctttgaagctgacaatgaggacgacttgttcgaatccatcctt
catgatgatgttctctatcctgtctggctcagcaaggaagctgtcagcatcctgaaagct
ttcatgaccaagaacccgcacaagcgcctgggctgtgtggcagcgcagaacggggaggac
gccatcaagcaacatccattcttcaaggagattgactgggtactgctggagcagaagaaa
atcaagccccccttcaagccgagaattaaaaccaaaagagatgtcaataactttgaccaa
gactttacgcgggaagagccaatacttacacttgtggatgaagcaatcattaagcagatc
aaccaggaagaattcaaaggcttctcctactttggtgaagacctgatgccctga

DBGET integrated database retrieval system