KEGG   Mus caroli (Ryukyu mouse): 110309157
Entry
110309157         CDS       T05910                                 

Gene name
Appl1
Definition
(RefSeq) DCC-interacting protein 13-alpha isoform X1
  KO
K08733  DCC-interacting protein 13 alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04211  Longevity regulating pathway
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    110309157 (Appl1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110309157 (Appl1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110309157 (Appl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110309157 (Appl1)
Membrane trafficking [BR:mcal04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110309157 (Appl1)
SSDB
Motif
Pfam: BAR_3 PID PH BAR PH_9
Other DBs
NCBI-GeneID: 110309157
NCBI-ProteinID: XP_021037282
Ensembl: MGP_CAROLIEiJ_G0019035
UniProt: A0A6P5QZN6
LinkDB
Position
14
AA seq 707 aa
MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHL
TSKLLKEYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPISQFKE
RDLKEILTLKEVFQIASNDHDAAISRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMH
YFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNGQLEEFLANIGTSVQNVRREM
DGDVETMQQTIEDLEVASDPLYLPDPDPTKFPINRNLTRKAGYLNARNKTGLVSSTWDRQ
FYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESK
KDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPGGQSRPP
TARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTNP
FGESGGSTKSETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMT
ESHLLVTCDCLKLIDPQTQVTRLTFPLPCVVLYATHQENKRLFGFVLRTSGGRSESNLSS
VCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELSKQKQIEK
DLEEQSRLIAASSRPNQAGSEGQLVLSSSQSEESDLGEEGKKRESEA
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgccggggatcgacaagctgcccattgaagagaccctggaggacagtccgcagacaagg
tctttacttggtgtatttgaagaagatgctactgctatttcaaattatatgaaccaatta
tatcaagctatgcatcggatttatgatgcacagaatgaattgagtgcagcaacacacctg
acttctaaacttttgaaagaatatgaaaaacagcgttttcctttggggggtgatgatgaa
gttatgagctctactttgcagcagttttccaaggtcatagatgagcttagttcttgtcat
gcagtactttcaactcaacttgctgatgccatgatgttccccatttcccagtttaaagaa
agagatctgaaagaaatattgacactaaaggaggtatttcaaattgctagtaatgatcat
gatgccgcaattagtaggtacagccggttgtcaaaaaagagagaaaatgacaaggtaaaa
tatgaagttacagaggatgtatatacttccaggaaaaaacaacaccagaccatgatgcat
tatttttgtgcactaaatactcttcagtacaagaagaaaatagctttgttagaaccccta
cttggatacatgcaggctcagataagtttctttaagatgggttctgaaaatctcaatgga
cagctggaagaattcttagctaacattggaacaagtgtacagaatgttcgaagagaaatg
gatggtgatgtagagaccatgcagcagacaatagaagacttggaggtagccagtgaccct
ttatatctgcccgacccagatcccaccaagtttcccatcaatcgaaatttaacccgaaag
gctggatacctaaatgctaggaataaaacaggcttggtgtcatctacctgggatagacag
ttttacttcacgcagggtggaaacttaatgagtcaagcccgtggagatgtggcaggaggc
ctcgccatggacatagacaactgttcggtgatggctgtggactgtgaagacagacgatac
tgttttcagatcacttcttttgatggaaaaaaatcttcaattttgcaagcagagagtaaa
aaagaccatgaagagtggatctgtacaataaacaacatatctaaacaaatatatttgagt
gaaaatccagaggaaactgctgcacgagtgaatcagtctgctctagaagctgtcactcct
tccccatctttccagcagagacacgagagcctgcgtccaggaggacaatctcggccacca
acagctcgaaccagcagttcaggatccttgggatcagagtctacaaatttggctgccctc
tctctagattctcttgttgctccagatacaccaatacagtttgatataatttctcctgtg
tgtgaagatcagcctggccaggcaaaagcctttggtcaaggaggcaggcgtacaaatcca
tttggagaatctggaggaagcacaaaatcagaaacagaagactctattcttcatcagtta
tttattgtccgattccttggttctatggaggtaaagtcagatgaccatccagatgttgtc
tatgaaacaatgcgccagatcttagctgctcgggccatccacaacatctttcgtatgaca
gaatcacatttattagtcacttgtgactgtttgaagttaattgatccgcagacccaagtt
acaaggctcacatttccattgccgtgtgtagttctatatgctacgcaccaggaaaataaa
cgactttttggatttgttctccggacatcaggcggaagaagtgagagtaatttgtcatca
gtctgctatatatttgaatcaaacaatgagggagaaaagatttgtgattctgttggactg
gcaaaacagatagctttgcatgctgaactggatcgtagggcatcagaaaaacaaaaagaa
atagagagagtaaaagagaaacaacagaaagagctcagcaaacagaaacagattgagaag
gacttggaagaacagagtcggttgatagctgcctccagtagaccaaaccaggctggtagt
gagggccagcttgttcttagcagtagccaatcagaggaaagtgatttgggagaagaaggg
aaaaaaagagagtcggaagcataa

DBGET integrated database retrieval system