KEGG   Mus caroli (Ryukyu mouse): 110309179
Entry
110309179         CDS       T05910                                 

Gene name
Rb1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04110  Cell cycle
mcal04218  Cellular senescence
mcal04934  Cushing syndrome
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05212  Pancreatic cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05220  Chronic myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110309179 (Rb1)
   04218 Cellular senescence
    110309179 (Rb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110309179 (Rb1)
   05203 Viral carcinogenesis
    110309179 (Rb1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110309179 (Rb1)
   05225 Hepatocellular carcinoma
    110309179 (Rb1)
   05226 Gastric cancer
    110309179 (Rb1)
   05214 Glioma
    110309179 (Rb1)
   05220 Chronic myeloid leukemia
    110309179 (Rb1)
   05218 Melanoma
    110309179 (Rb1)
   05219 Bladder cancer
    110309179 (Rb1)
   05215 Prostate cancer
    110309179 (Rb1)
   05224 Breast cancer
    110309179 (Rb1)
   05222 Small cell lung cancer
    110309179 (Rb1)
   05223 Non-small cell lung cancer
    110309179 (Rb1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110309179 (Rb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110309179 (Rb1)
   05161 Hepatitis B
    110309179 (Rb1)
   05160 Hepatitis C
    110309179 (Rb1)
   05163 Human cytomegalovirus infection
    110309179 (Rb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110309179 (Rb1)
   05169 Epstein-Barr virus infection
    110309179 (Rb1)
   05165 Human papillomavirus infection
    110309179 (Rb1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110309179 (Rb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110309179 (Rb1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110309179 (Rb1)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110309179 (Rb1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    110309179 (Rb1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 RuvC_1 FAM75
Other DBs
NCBI-GeneID: 110309179
NCBI-ProteinID: XP_021037313
Ensembl: MGP_CAROLIEiJ_G0019499
UniProt: A0A6P5QZ69
LinkDB
Position
14
AA seq 922 aa
MPPKAPRRAAAAEPPPPPPPPPPREDDPAQDSGPEELPLARLEFEEIEEPEFIALCQKLK
VPDHVRERAWLTWEKVSSVDGILEGYIQKKKELWGICIFIAAVDLDEMPFTFTELQKSIE
TSVYKFFDLLKEIDTSTKVDNAMSRLLKKYNVLCALYSKLERTCELIYLTQPSSALSTEI
NSMLVLKISWITFLLAKGEVLQMEDDLVISFQLMLCVVDYFIKFSPPALLREPYKTAAIP
INGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHKCNIDEVKNVYFKNFIPFINSLGI
VSSNGLPEVESLSKRYEEVYLKNKDLDARLFLDHDKTLQTDPIDSFETERTPRKNNPDEE
ANVVTPHTPVRTVMNTIQQLMVILNSASDQPSENLISYFNNCTVNPKENILKRVKDVGHI
FKEKFANAVGQGCVDIGVQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMS
LLACALEVVMATYSRSTLQHLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKVEANLTRE
MIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDGEGPDNLEPACPLSLPLQSNHTAADMY
LSPLRSPKKRTSTTRVNSAANTETQAASSFHTQKPLKSTSLSLFYKKVYRLAYLRLNTLC
ARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVT
AYKDLPHAAQETFKRVLIREEEFDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIP
RSPYKFSSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQ
KINQMVCNSDRVLKRSAEGGNPPKPLKKLRFDIEGADEADGSKHLPAESKFQQKLAEMTS
TRTRMQKQRMNESMDVSNKEEK
NT seq 2769 nt   +upstreamnt  +downstreamnt
atgccgcccaaagccccgcgcagagccgcggccgccgagcccccgccaccgccgccgccg
ccgccgcctcgggaggacgaccccgcgcaggacagcggccccgaagagctgcccctggcc
aggcttgagtttgaagaaattgaagaacccgaatttattgcattatgtcagaagttaaag
gtaccggatcatgtcagagaaagagcttggctaacttgggagaaagtttcatccgtggac
ggaatcctggaaggatatattcaaaagaagaaggaactctggggcatctgcatctttatc
gcagcagttgatctagatgagatgccattcactttcactgagctacagaaaagcatagaa
accagtgtctataaattctttgacttattaaaagaaattgataccagtaccaaggttgat
aatgctatgtcaagactattgaagaagtataatgtgttatgtgcactctacagcaaatta
gaacggacatgtgaacttatatatttgacacaacccagcagtgcgttatctactgaaata
aattctatgttggtgctaaaaatttcttggatcacttttttactagctaaaggagaagta
ttacagatggaagatgacctggtaatctcatttcagctaatgttgtgtgtagttgactat
tttattaagttctcgcctcctgcactactcagagagccatacaaaacagctgcaatcccc
attaatggttcgcctcgaacacccagaagaggtcagaacaggagtgctcggatagcaaaa
caactagaaaatgatacgagaattatcgaagttctctgtaaagaacacaagtgtaatata
gatgaggtgaaaaatgtttatttcaaaaattttatcccttttataaattcacttggaatt
gtatcatctaatggacttccagaggttgaaagtctttctaaacgctatgaagaagtttat
cttaaaaacaaagatttagatgcaagactatttttggatcatgataaaacacttcagact
gatcctatagacagttttgaaacagagagaacgccacgaaaaaacaaccctgatgaagag
gcaaacgtggttactccacacactccagttaggactgttatgaatactattcaacaatta
atggtgattttaaattctgcaagtgatcagccatcagaaaatctgatttcctacttcaat
aattgcacagtgaatccaaaagaaaatatcctaaagagagtaaaggatgttgggcacatc
tttaaagagaagtttgctaacgctgtgggccagggctgtgttgacatcggagtacagcga
tataaacttggagtccgattgtattaccgtgtgatggaatccatgcttaaatcagaagaa
gaacgtttgtccattcagaattttagcaaactcctaaatgacaacatctttcatatgtct
ttattggcctgtgctcttgaagttgtaatggctacgtatagcagaagtacattacagcat
cttgattctggaacagatttgtccttcccgtggattctgaatgtacttaatttaaaagcc
tttgatttttacaaagtgattgaaagttttatcaaagtggaagccaacttgacaagagaa
atgataaaacatttagaaagatgtgagcatcgaatcatggaatcccttgcatggctttca
gattcacctttatttgatctcattaagcagtccaaggatggagaaggacctgataacctt
gaacctgcttgtcctctcagcctccctctccagagtaaccatactgcagcagatatgtat
ctttctcctctaagatctccaaagaaaagaacttccactacacgtgtaaattctgctgca
aatacagagacacaagcagcctcatccttccatactcagaagccattgaaatctacctcc
ctttccctgttttacaaaaaagtgtaccgtctagcatatctccgactaaatacactctgt
gcacgccttctgtctgaccacccagagctagagcacatcatctggaccctgtttcagcat
acattgcaaaatgagtatgagctcatgagagaccggcatttggaccagattatgatgtgc
tctatgtatggcatctgcaaggtgaagaatattgaccttaagttcaaaatcatcgtaact
gcgtacaaggatcttcctcacgctgcccaggagacctttaaacgtgttttgatcagagaa
gaggagtttgattccattatagtattctataactcagttttcatgcagagactaaaaaca
aatattttacagtatgcctccaccaggcctcctaccttgtcaccaatacctcacattcct
cgaagcccttacaagttttctagttcacccttacggattcctggaggtaacatctatata
tcacccctaaagagtccttataaaatttcagaaggtctgccaacacccacaaaaatgact
ccgagatcaagaatcttggtctcaattggtgaatcatttgggacatctgagaagttccag
aaaataaaccagatggtgtgtaatagtgacagagtgctcaaaagaagtgctgaaggcggc
aacccccccaaaccactgaaaaagctgcgctttgacatcgagggagccgatgaagcagat
gggagtaaacatctcccagcggagtccaaattccaacagaaactggcggaaatgacttcc
actcgaacacgaatgcaaaagcagagaatgaatgagagcatggatgtctcaaacaaggag
gaaaagtga

DBGET integrated database retrieval system