KEGG   Mus caroli (Ryukyu mouse): 110309199
Entry
110309199         CDS       T05910                                 

Gene name
Rarb
Definition
(RefSeq) retinoic acid receptor beta isoform X1
  KO
K08528  retinoic acid receptor beta
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110309199 (Rarb)
  09162 Cancer: specific types
   05226 Gastric cancer
    110309199 (Rarb)
   05222 Small cell lung cancer
    110309199 (Rarb)
   05223 Non-small cell lung cancer
    110309199 (Rarb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110309199 (Rarb)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mcal03310]
    110309199 (Rarb)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    110309199 (Rarb)
Nuclear receptors [BR:mcal03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   110309199 (Rarb)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 110309199
NCBI-ProteinID: XP_021037349
Ensembl: MGP_CAROLIEiJ_G0018970
LinkDB
Position
14
AA seq 479 aa
MSTSSHACPVPAVRGHMTHYPAAPYPLLFPPVIRGLSLPPLHGHPPPSGCSTPSPASVGQ
ACQRTTGGSQFAASTKWTPSLNAAIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSS
GYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKE
SVRNDRNKKKKEPSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADH
RVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTR
YTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLIC
GDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVI
TLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNIAEHSPSVSPSSVENSGVSQSPLLQ
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcaccagcagccacgcatgcccagtcccggcagtgcgtggacacatgactcactac
ccagctgcaccctacccattactgttcccacctgtcatcagaggactctccctgcctcca
ctccatggccacccacctcccagtggatgcagcaccccatcaccagccagtgtggggcag
gcatgtcagaggacaactggtggaagtcagtttgcagcttctaccaagtggacaccaagc
ttgaatgcagccatcgagacacagagtaccagctctgaggagctcgtcccgagcccacca
tctccacttcctcctcctcgggtgtacaagccctgcttcgtttgccaggacaagtcatca
ggctaccactatggcgtcagtgcctgtgaggggtgcaagggctttttccgccgaagtatt
cagaagaacatgatctacacttgccatcgagataagaactgcgttattaacaaggtcact
agaaaccgatgccagtactgccgcctgcagaagtgctttgaagtgggcatgtccaaagag
tctgttaggaatgacaggaacaagaaaaagaaggagccttcaaagcaggaatgcacagag
agctatgagatgacagcggagctagacgacctcactgagaagatccggaaagcccaccag
gaaacctttccctcactctgccagctgggtaaatacaccacgaattccagcgctgaccac
cgggtccgattggacttgggcctctgggacaaattcagtgagctggccaccaagtgcatt
attaagatcgtggagttcgccaagcgtctgccgggcttcacaggtctgaccatcgcagac
cagatcaccctgctcaaagccgcctgcttggatatcttgattctcagaatttgtaccagg
tataccccagagcaagacaccatgactttctctgatggccttacactaaatcgaactcag
atgcacaatgctggcttcggtcctctgactgaccttgtgttcacctttgccaaccagctc
ctgcctttggaaatggatgacacagaaacaggccttctcagtgccatctgtttaatctgt
ggagaccgccaggaccttgaggaaccaacaaaagtagacaaactccaagaaccactgctg
gaagcactaaagatttacattagaaaacgacggcccagcaagcctcacatgtttccaaag
atcttaatgaaaatcacagatctccgcagcatcagcgcaaaaggtgccgaacgtgtaatt
accttgaaaatggaaattcctggatcaatgccacctctcattcaggaaatgctggagaat
tctgaaggacatgaacccttgaccccaagttcaagtgggaatatagcagagcacagtccc
agcgtgtcccccagctcagtggagaacagtggagtcagtcagtcaccactgctgcagtga

DBGET integrated database retrieval system