KEGG   Mus caroli (Ryukyu mouse): 110309320
Entry
110309320         CDS       T05910                                 

Gene name
Nkx3-1
Definition
(RefSeq) homeobox protein Nkx-3.1
  KO
K09348  homeobox protein Nkx-3.1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05200  Pathways in cancer
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110309320 (Nkx3-1)
  09162 Cancer: specific types
   05215 Prostate cancer
    110309320 (Nkx3-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110309320 (Nkx3-1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    110309320 (Nkx3-1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN Homez YjbH
Other DBs
NCBI-GeneID: 110309320
NCBI-ProteinID: XP_021037568
Ensembl: MGP_CAROLIEiJ_G0019459
UniProt: A0A6P5R2J7
LinkDB
Position
14
AA seq 237 aa
MLRVAEPREPRVEAGGRSPWAAPPTQSKRLTSFLIQDILRDRAERHGGHSGNPQHSPDPR
RDSAPEPDKAGGRGVAPEVPPSIRRSPTETPTEPESDAHFETYLLDCEHNPGDLSSPPQV
TKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKT
KRKQLSEDLGVLEKNSPLSLPALKDDSLPSTSLVSVYTSYPYYPYLYCLGSWHPSFW
NT seq 714 nt   +upstreamnt  +downstreamnt
atgcttagggtagcggagccccgagagccacgggtggaggcgggtggccgcagtccttgg
gcagcgccacccacgcagtccaagcggctcacctccttcctcatccaggacatcctgcgg
gaccgcgcggagcggcacgggggacactcaggcaatccgcagcactcgccggaccctagg
agggactccgctccagagcccgacaaagcagggggtcgcggcgtggctccggaggtcccg
ccgagtatccggcgtagtcccacggagacaccgactgaacccgagtctgatgcacatttt
gagacttatctgttggactgtgaacataatccaggggacttatcaagtcccccccaggtc
accaagcagccacagaagcgctcccgggccgccttctctcacactcaggtgattgagttg
gagagaaagttcagccatcagaagtacctgtctgcccccgaaagggctcacctggccaag
aacctcaaactcaccgaaacccaagtcaaaatatggttccagaacagacgctataagact
aagcgaaagcagctatcggaagacctgggagtcttggagaagaactcaccattgtctttg
ccagccctgaaagatgacagcctgcccagtacctccttggtctccgtgtatactagctat
ccctactacccctacctgtactgtctgggcagctggcatccatctttctggtaa

DBGET integrated database retrieval system