KEGG   Mus caroli (Ryukyu mouse): 110309476
Entry
110309476         CDS       T05910                                 

Definition
(RefSeq) interleukin-3 receptor subunit alpha isoform X1
  KO
K04737  interleukin 3 receptor alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04630  JAK-STAT signaling pathway
mcal04640  Hematopoietic cell lineage
mcal05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110309476
   04151 PI3K-Akt signaling pathway
    110309476
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110309476
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110309476
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110309476
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110309476
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcal04050]
    110309476
   04090 CD molecules [BR:mcal04090]
    110309476
Cytokine receptors [BR:mcal04050]
 Interleukin receptor families
  IL3 receptor family
   110309476
CD molecules [BR:mcal04090]
 Proteins
  110309476
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N
Other DBs
NCBI-GeneID: 110309476
NCBI-ProteinID: XP_021037814
Ensembl: MGP_CAROLIEiJ_G0018962
LinkDB
Position
14
AA seq 430 aa
MGVNQSLSPAYFLFHPLTSCHGDWCQSKPRHCPQLWMSPVTQAPPRLPLTTAAVPEAPPT
AVTTPIRNLRIDPAHHMLIWDPVPGADITTGAYCRKGRDNFVWADPGLARCSFQSLSLCH
VTNFTVFLGKDSAVAGSIRFPPDDGGNHEAAAQDLRCWVYEGQLSCRWGRGPKAAGDVHY
RMFWRDVRLGPAHDRECPHYHSHDVNTTGPAPHGSHEGCTLDLDPVLGSAPNGPKEDLVP
QFTITINGSSPAGPVPCMDDTVDLQRAEVLAPPTLTVECIGSEAHARWDAQTRFHYGHLR
FTLQVNQSSSSEPQEYNVSVPHFWVPNAGAISFRVRSRSEVDPQKLSSWSKAWGLVCPPE
VTPVKTALVTSVATVLGAGLLAAGLLLWWRKSLLSRLCPPIPRLRLPLAGEMVAWEPGPE
DCEVTPVTDA
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgggtgtcaatcaaagcctaagtcccgcctactttcttttccaccccctcacttcctgt
cacggagattggtgtcaatcaaagcccaggcactgcccacaactgtggatgtcacctgtc
actcaagccccaccccgcctccccttgacaacagctgctgtccccgaggctccacccact
gctgtgaccacgcccatccggaacctgcgcattgaccctgcccaccacatgctgatctgg
gaccctgtccctggtgctgacatcacaacaggggcttattgcaggaagggcagggacaac
tttgtctgggctgaccctggacttgcccgctgctcgttccagtcactctccctctgccat
gtgaccaacttcactgtcttcctggggaaggacagtgctgtggcgggatccatccggttc
cccccagacgatggtggcaaccatgaggccgcagctcaggacctgcgctgctgggtgtat
gaggggcagctgagctgccgctgggggcggggtccgaaagcagcgggtgacgtgcactac
cggatgttctggcgtgatgtgcggcttggtcctgcccatgaccgcgagtgtccacactac
cacagccatgatgtcaacaccactggccctgcccctcatggcagccatgaaggctgcacc
cttgacctcgaccctgtccttggctccgcccccaatggccccaaggaagaccttgtcccc
cagttcaccatcaccatcaatggcagcagccccgctggccccgtgccctgcatggatgac
accgtggacctgcagcgcgcagaggtcctggccccgcccacactgaccgtggagtgcatc
ggctccgaggcccatgcacgctgggacgcgcagacccgattccactatggccaccttcgg
ttcaccctgcaggtcaaccagagctccagctcagagccgcaggaatacaatgtctccgtc
ccccacttctgggtccccaacgctggcgccatctccttccgggtcaggtcgaggtcagag
gttgaccctcagaagctcagcagctggagcaaagcctggggcctcgtctgccccccagag
gtgacacctgtgaagacagccttggtgacgtcggtggctacggtgcttggagcaggactc
ttggcagctgggctcctgctgtggtggaggaagtcgctgctctcccgcctgtgcccaccc
atcccacgcctgcgcctgcccttggcaggggagatggtcgcgtgggaaccgggtcctgag
gactgcgaggtgacgcccgtgacagacgcctga

DBGET integrated database retrieval system