KEGG   Mus caroli (Ryukyu mouse): 110309527
Entry
110309527         CDS       T05910                                 

Gene name
Fhit
Definition
(RefSeq) bis(5'-adenosyl)-triphosphatase
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00230  Purine metabolism
mcal01100  Metabolic pathways
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110309527 (Fhit)
 09160 Human Diseases
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110309527 (Fhit)
   05223 Non-small cell lung cancer
    110309527 (Fhit)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     110309527 (Fhit)
SSDB
Motif
Pfam: HIT DcpS_C LPD29 CwfJ_C_1
Other DBs
NCBI-GeneID: 110309527
NCBI-ProteinID: XP_021037914
Ensembl: MGP_CAROLIEiJ_G0018948
UniProt: A0A6P7QI77
LinkDB
Position
14
AA seq 150 aa
MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQ
ATQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPQNDNIYDELQKH
DREEEDSPALWRSEEEMAAEADALRVYFQA
NT seq 453 nt   +upstreamnt  +downstreamnt
atgtcatttagatttggccaacatctcatcaagccctccgtggtttttctcaaaactgag
ctgtccttcgccctggtgaataggaaacccgttgtacctggccatgtcctcgtgtgccca
ctaaggccagtagagcgcttccgtgacctacatcctgatgaagtggctgatttgtttcaa
gcgacccagagagttgggacagtggtggagaagcatttccaggggacctccatcaccttc
tccatgcaagatggccctgaagctggacagactgtgaagcatgtacatgtccacgttctt
cccaggaaggcaggggacttcccccagaatgacaacatctatgatgagctccagaaacat
gacagagaagaagaggactcaccagccctttggagatctgaggaggagatggctgcagag
gcggacgctctgcgggtctactttcaggcatga

DBGET integrated database retrieval system