KEGG   Mus caroli (Ryukyu mouse): 110309649
Entry
110309649         CDS       T05910                                 

Gene name
Tnfsf11
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 11 isoform X1
  KO
K05473  tumor necrosis factor ligand superfamily member 11
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04064  NF-kappa B signaling pathway
mcal04380  Osteoclast differentiation
mcal04917  Prolactin signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal05224  Breast cancer
mcal05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110309649 (Tnfsf11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110309649 (Tnfsf11)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110309649 (Tnfsf11)
   04928 Parathyroid hormone synthesis, secretion and action
    110309649 (Tnfsf11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110309649 (Tnfsf11)
 09160 Human Diseases
  09162 Cancer: specific types
   05224 Breast cancer
    110309649 (Tnfsf11)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110309649 (Tnfsf11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110309649 (Tnfsf11)
   04090 CD molecules [BR:mcal04090]
    110309649 (Tnfsf11)
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Tumor necrosis fators
   110309649 (Tnfsf11)
CD molecules [BR:mcal04090]
 Proteins
  110309649 (Tnfsf11)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 110309649
NCBI-ProteinID: XP_021038039
Ensembl: MGP_CAROLIEiJ_G0019532
UniProt: A0A6P5QU83
LinkDB
Position
14
AA seq 316 aa
MRRASRDYGKYLRSSEEMGSGPGVPHEGPLHPAPSAPAPAPPPAASRSMFLALLGLGLGQ
VVCSIALFLYFRAQMYPNRISEDSTHCFYRILRLHENAGLQDSTPESEDTLPDSCRRMKQ
AFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVTQRGKPEAQPFAHLTINAASIPSGSHK
VTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVY
VVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDP
DQDATYFGAFKVQDID
NT seq 951 nt   +upstreamnt  +downstreamnt
atgcgccgggccagccgagactacggcaagtacctgcgcagctcggaggagatgggcagc
ggccccggcgtcccacacgagggtccgctgcaccccgcgccttcagcaccggctccggcg
ccaccacccgccgcctcccgctccatgttcctggccctcctggggctgggactgggccag
gtggtctgcagcatcgctctgttcctgtactttcgagcgcagatgtatcctaacagaata
tcagaagacagcactcactgcttttatagaatcctgagactccatgaaaacgcaggtttg
caggactcgactccggagagtgaagacacactacctgactcctgcaggaggatgaaacaa
gcctttcagggggctgtgcaaaaggaactgcaacacattgtggggccacagcgcttctca
ggagctccagctatgatggaaggctcatggttagatgtgacccagcgaggcaagcctgag
gcccagccatttgcacacctcaccatcaatgctgccagcatcccatcgggttcccataaa
gtcactctgtcctcttggtaccacgatcgaggctgggccaagatctctaacatgacgtta
agcaacggaaaactaagggttaaccaagatggcttctattacctgtacgccaacatttgc
tttcggcatcacgagacatcgggaagcgtacctacagactaccttcagctgatggtgtat
gtcgttaaaaccagcatcaaaatcccaagttctcataacctgatgaaaggagggagcaca
aaaaactggtcgggcaattctgaattccacttctattccataaatgttgggggatttttc
aagctccgagctggtgaagaaattagcattcaggtgtccaacccttccctgctggatccg
gatcaagatgcgacgtactttggggctttcaaagttcaggacatagactga

DBGET integrated database retrieval system