KEGG   Mus caroli (Ryukyu mouse): 110309656
Entry
110309656         CDS       T05910                                 

Gene name
Plau
Definition
(RefSeq) urokinase-type plasminogen activator
  KO
K01348  urokinase plasminogen activator [EC:3.4.21.73]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04064  NF-kappa B signaling pathway
mcal04610  Complement and coagulation cascades
mcal05202  Transcriptional misregulation in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110309656 (Plau)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110309656 (Plau)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110309656 (Plau)
   05206 MicroRNAs in cancer
    110309656 (Plau)
   05205 Proteoglycans in cancer
    110309656 (Plau)
  09162 Cancer: specific types
   05215 Prostate cancer
    110309656 (Plau)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcal01002]
    110309656 (Plau)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110309656 (Plau)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.73  u-plasminogen activator
     110309656 (Plau)
Peptidases and inhibitors [BR:mcal01002]
 Serine peptidases
  Family S1: chymotrypsin family
   110309656 (Plau)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   110309656 (Plau)
SSDB
Motif
Pfam: Trypsin Kringle DUF316 EGF_2
Other DBs
NCBI-GeneID: 110309656
NCBI-ProteinID: XP_021038045
Ensembl: MGP_CAROLIEiJ_G0019001
UniProt: A0A6P5R6Z3
LinkDB
Position
14
AA seq 432 aa
MNSLEHVTSGDSHLHLLQGGSVLGTPDESNCGCQNGGVCVSYKYFSSIRRCSCPRKFQGE
HCEIDASKTCYHGNGDSYRGKANTDTKGRPCLAWNAPAVLQKPYNAHRPDAISLGLGKHN
YCRNPDNQKRPWCYVQIGLKQFVQECMVHDCSLSKKPSSSVDQQGFQCGQKALRPRFKIV
GGEFTEVENQPWFAAIYQKNKAGSPPSFKCGGSLISPCWVASAAHCFIHLPKKENYVVYL
GQSKQSSYNPGEMKFEVEQLILHEDYSEDGLAYHNDIALLKIRTSTGQCAQPSRSIQTIC
LPPRFTDAPFGSDCEITGFGKESEGDYLYPNNLKMSVVKLVSHEECMQPHYYGSEINYKM
LCAADPEWKTDSCKGDSGGPLICNIEGRPTLSGIVSWGRGCAEKNKPGVYTRVSHFLGWI
QSHIGEEKGLAF
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgaattccctagagcatgtcacctctggtgactcccaccttcatctcttgcagggtggc
agtgtacttggaactcctgatgaatcaaactgtggctgtcagaacggaggtgtatgcgtg
tcctacaagtacttctccagcattcgccgatgcagctgcccaaggaaattccagggggag
cactgtgagatagatgcatcaaaaacctgctatcatggaaatggtgactcttatcgagga
aaggccaacactgataccaaaggtcggccctgcctggcctggaatgcgcctgctgtcctt
cagaaaccctacaatgcccacagacctgatgctattagcttaggcctggggaaacacaat
tactgcaggaaccctgacaaccagaagcgaccctggtgctatgtgcagattggcctaaag
cagtttgtccaagaatgcatggtgcatgactgctctcttagcaaaaagccttcttcgtct
gtagaccaacaaggcttccagtgtggccagaaggctctaaggccccgctttaagattgtt
gggggagaattcacggaggtggagaaccagccctggtttgcagccatctaccagaagaac
aaagcaggaagtcctccctcctttaaatgtggtgggagtctcatcagtccctgctgggtg
gccagtgccgcacactgcttcattcacctcccaaagaaggaaaactacgttgtctacctg
ggtcagtcgaagcagagctcctataatcctggagagatgaagtttgaggtggagcagctc
atcttgcacgaagactacagtgaagacggcctggcctaccataatgacattgccttgctg
aagatacgtaccagcacgggccaatgtgcacagccatccaggtccatacagaccatctgc
ctgcccccaaggtttactgatgctccgtttggttcagactgtgagatcactggctttgga
aaagagtctgaaggtgactacctctatccaaataacctgaaaatgtccgttgtaaagctt
gtttctcatgaagagtgtatgcagccccactactacggctctgaaattaattataaaatg
ctgtgtgctgcggacccagagtggaaaacagattcctgcaagggcgattctggaggaccg
cttatctgtaacatcgaaggccgcccaactctgagtgggattgtgagctggggccgagga
tgtgcagagaaaaacaagcccggcgtctacacgagggtctcacacttcctgggctggatt
caatcccacattggagaagagaaaggtctggccttctga

DBGET integrated database retrieval system