KEGG   Mus caroli (Ryukyu mouse): 110310004
Entry
110310004         CDS       T05910                                 

Gene name
Tymp
Definition
(RefSeq) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00240  Pyrimidine metabolism
mcal00983  Drug metabolism - other enzymes
mcal01100  Metabolic pathways
mcal05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    110310004 (Tymp)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    110310004 (Tymp)
 09160 Human Diseases
  09162 Cancer: specific types
   05219 Bladder cancer
    110310004 (Tymp)
Enzymes [BR:mcal01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     110310004 (Tymp)
SSDB
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C
Other DBs
NCBI-GeneID: 110310004
NCBI-ProteinID: XP_021038382
Ensembl: MGP_CAROLIEiJ_G0020165
UniProt: A0A6P5R2F4
LinkDB
Position
15
AA seq 471 aa
MAAPGTPPPLASGGGSGEPRQLPELIRLKRDGGHLREADIRNFVHAVIDGRAQDTQIGAM
LMAIRLQGMNLEETSVLTRALAESGQQLEWPKAWHQQLVDKHSTGGVGDKVSLVLAPALA
ACGCKVPMISGRSLGHTGGTLDKLESIPGFSVTQSPEQMLHILEEVGCCIVGQSAKLVPA
DGILYAARDVTATVDSVPLITASILSKKAVEGLSALVVDVKFGGAAVFPDQEKARELAKM
LVRVGVSLGLKVAAALTAMDNPLGRSVGHTLEVEEALLCLDGAGPPDLRDLVIRLGGAIL
WLSGQAETQDQGAARVAAALDDGSARRRFQLMLSAQGVDPDLAKALCSGSPTQRRQLLPH
AREQEELLAPADGIVECVRALPLARVLHDLGAGRSRAGQPIRPGVGAEVLVDVGQCLSRG
TPWLRVHLDGPALSSQQRRTLQGALVLSDRAPFKVPSPFAELVLPPTTAQP
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggcagctccagggacaccacctcccttggcctcagggggagggagtggggagcctagg
cagctgcctgagctgatccgcctgaagcgagatggagggcatctaagagaagcagatatc
agaaacttcgtgcacgcggtgatagatggaagagcacaggacacacaaattggggccatg
ctaatggccattcggctgcagggcatgaacctagaagagacatctgtgctgactcgggcc
ctcgcagagtctgggcagcaactggagtggcccaaggcctggcaccagcagcttgttgac
aaacactccacaggaggtgtgggtgacaaggttagcctggttctggcacctgccctggct
gcatgcggctgtaaggtgccaatgatcagcggccgcagtctgggacacacagggggcaca
ctggataagctggaatcgattcctgggttcagtgtcacccagagcccagagcagatgctg
cacatccttgaggaagtcggctgctgcattgtcggccagagtgcaaagctggttcctgct
gatgggatcctgtatgctgcacgagatgtgacagccactgtggacagtgtcccgctcatt
acagcttcaatcctcagtaagaaggccgtggagggactgtctgctctggtggtagatgtt
aagtttgggggagctgcagtcttcccagaccaggagaaggcccgagaactggcaaagatg
ttggttagagtgggagtgagcctggggctgaaggtcgccgcagccctgaccgccatggat
aaccctctgggccgcagcgtgggccataccctggaagtggaagaagcgttgctttgcctg
gatggtgcggggccgcccgatctgcgggacctggtcattaggctaggaggcgccattctt
tggcttagcggacaggcggaaacacaagaccaaggcgccgcccgagtggccgcggcgttg
gatgacggctctgcgcggcgccgcttccagttgatgctttcggcgcagggcgtggacccc
gacctagctaaagcattgtgctccgggagccccacgcaacgccggcagctgctgcctcac
gcccgagagcaagaggagctgctcgcaccggcagacggcattgtggagtgcgtccgagcg
ctgccgctggcccgtgtgctgcacgacctcggagccggacgcagccgagcggggcagccg
atcagaccgggagtgggtgccgaggtactggtcgacgtgggccagtgtttgtcccgaggg
acaccctggctccgcgtgcacctagacggccctgcgctcagcagtcagcagcgacgcact
ctccagggggcgctcgtgctatcagatcgagcacccttcaaggtcccttcaccctttgct
gaacttgtcctcccaccgaccaccgcacagccctaa

DBGET integrated database retrieval system