KEGG   Mus caroli (Ryukyu mouse): 110310031
Entry
110310031         CDS       T05910                                 

Gene name
Src
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04012  ErbB signaling pathway
mcal04015  Rap1 signaling pathway
mcal04062  Chemokine signaling pathway
mcal04137  Mitophagy - animal
mcal04144  Endocytosis
mcal04360  Axon guidance
mcal04370  VEGF signaling pathway
mcal04510  Focal adhesion
mcal04520  Adherens junction
mcal04530  Tight junction
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04613  Neutrophil extracellular trap formation
mcal04625  C-type lectin receptor signaling pathway
mcal04727  GABAergic synapse
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04810  Regulation of actin cytoskeleton
mcal04912  GnRH signaling pathway
mcal04915  Estrogen signaling pathway
mcal04917  Prolactin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04926  Relaxin signaling pathway
mcal05100  Bacterial invasion of epithelial cells
mcal05135  Yersinia infection
mcal05152  Tuberculosis
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05203  Viral carcinogenesis
mcal05205  Proteoglycans in cancer
mcal05219  Bladder cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110310031 (Src)
   04015 Rap1 signaling pathway
    110310031 (Src)
   04370 VEGF signaling pathway
    110310031 (Src)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110310031 (Src)
   04137 Mitophagy - animal
    110310031 (Src)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110310031 (Src)
   04520 Adherens junction
    110310031 (Src)
   04530 Tight junction
    110310031 (Src)
   04540 Gap junction
    110310031 (Src)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110310031 (Src)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110310031 (Src)
   04613 Neutrophil extracellular trap formation
    110310031 (Src)
   04625 C-type lectin receptor signaling pathway
    110310031 (Src)
   04062 Chemokine signaling pathway
    110310031 (Src)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110310031 (Src)
   04915 Estrogen signaling pathway
    110310031 (Src)
   04917 Prolactin signaling pathway
    110310031 (Src)
   04921 Oxytocin signaling pathway
    110310031 (Src)
   04926 Relaxin signaling pathway
    110310031 (Src)
   04919 Thyroid hormone signaling pathway
    110310031 (Src)
  09156 Nervous system
   04727 GABAergic synapse
    110310031 (Src)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110310031 (Src)
  09158 Development and regeneration
   04360 Axon guidance
    110310031 (Src)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110310031 (Src)
   05203 Viral carcinogenesis
    110310031 (Src)
  09162 Cancer: specific types
   05219 Bladder cancer
    110310031 (Src)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110310031 (Src)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110310031 (Src)
   05152 Tuberculosis
    110310031 (Src)
   05100 Bacterial invasion of epithelial cells
    110310031 (Src)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110310031 (Src)
   05168 Herpes simplex virus 1 infection
    110310031 (Src)
   05163 Human cytomegalovirus infection
    110310031 (Src)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110310031 (Src)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110310031 (Src)
   01522 Endocrine resistance
    110310031 (Src)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110310031 (Src)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110310031 (Src)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     110310031 (Src)
Protein kinases [BR:mcal01001]
 Non-receptor tyrosine kinases
  SRC family
   110310031 (Src)
Membrane trafficking [BR:mcal04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    110310031 (Src)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    110310031 (Src)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    110310031 (Src)
  Macropinocytosis
   Kinases
    110310031 (Src)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3
Other DBs
NCBI-GeneID: 110310031
NCBI-ProteinID: XP_021038404
Ensembl: MGP_CAROLIEiJ_G0024576
LinkDB
Position
2
AA seq 535 aa
MGSNKSKPKDASQRRRSLEPSENVHGAGGAFPASQTPSKPASADGHRGPSAAFVPPAAEP
KLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDW
WLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESE
TTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLC
HRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLK
PGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKGETGKYL
RLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTA
RQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERG
YRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggacgccagccagcggcgccgcagcctggagccc
tcggaaaacgtgcacggggcagggggcgccttcccggcctcacagacaccgagcaagccc
gcctccgccgacggccaccgcgggcccagcgccgccttcgtgccgcccgcggccgagccc
aagctcttcggaggcttcaactcctcggacaccgtcacctccccgcagagggcggggcct
ctggcaggtggggtgaccacctttgtggccctctatgactatgagtcacggacagagact
gacctgtccttcaagaaaggggagcggctgcagattgtcaataacacagagggagactgg
tggttggcacactcgctgagcacgggacagaccggttacatccccagcaactatgtggcg
ccctccgactccatccaggctgaggagtggtactttggcaagatcactagacgggaatca
gagcggctgctgctcaacgccgagaacccgagaggtaccttcctcgtgagggagagtgag
accacaaaaggtgcctactgcctctctgtatccgacttcgacaatgccaagggcctaaat
gtgaaacactacaagatccgcaagctggacagcggcgggttctacatcacctcccgcacc
cagttcaacagcctgcagcagctcgtggcttactactccaaacatgctgatggcctgtgt
caccgcctcactactgtgtgtcccacatccaagcctcagacccagggattggccaaggat
gcgtgggagatcccccgggagtccctgcggctggaggtcaagctgggccagggttgcttc
ggagaggtgtggatggggacttggaacggcaccacgagggttgccatcaaaaccctgaag
ccaggcaccatgtccccagaggccttcctgcaggaggcccaagtcatgaagaaactgagg
cacgagaaactggtgcagctgtatgctgtggtgtcagaagaacccatttacattgtgaca
gagtacatgaacaaggggagtctgctggactttctcaagggggaaacgggcaaatatttg
cggctaccccagctggtggacatgtctgctcagatcgcttcaggcatggcctatgtggag
cggatgaactatgtgcaccgggacctccgagccgccaatatcctagtaggggagaacctg
gtgtgcaaagtggccgactttgggttggcccggctcatagaagacaacgaatacacagcc
cggcaaggtgccaaattccccatcaagtggaccgcccctgaagctgctctgtacggcagg
ttcaccatcaagtcggatgtgtggtcctttgggattctgctgaccgagctcaccactaag
ggaagagtgccctatcctgggatggtgaaccgtgaggttctggaccaggtggagcggggc
taccggatgccttgtccccccgagtgccccgagtccctgcatgacctcatgtgccagtgc
tggcggaaggagcccgaggagcggcccaccttcgagtacctgcaggccttcctggaagac
tactttacgtccactgagccacagtaccagcccggggagaacctatag

DBGET integrated database retrieval system