KEGG   Mus caroli (Ryukyu mouse): 110310111
Entry
110310111         CDS       T05910                                 

Gene name
Sp1
Definition
(RefSeq) transcription factor Sp1
  KO
K04684  transcription factor Sp1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04137  Mitophagy - animal
mcal04350  TGF-beta signaling pathway
mcal04915  Estrogen signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05163  Human cytomegalovirus infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05224  Breast cancer
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110310111 (Sp1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110310111 (Sp1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110310111 (Sp1)
   04928 Parathyroid hormone synthesis, secretion and action
    110310111 (Sp1)
   04927 Cortisol synthesis and secretion
    110310111 (Sp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110310111 (Sp1)
   05202 Transcriptional misregulation in cancer
    110310111 (Sp1)
   05231 Choline metabolism in cancer
    110310111 (Sp1)
  09162 Cancer: specific types
   05224 Breast cancer
    110310111 (Sp1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110310111 (Sp1)
   05017 Spinocerebellar ataxia
    110310111 (Sp1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110310111 (Sp1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110310111 (Sp1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110310111 (Sp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110310111 (Sp1)
   03029 Mitochondrial biogenesis [BR:mcal03029]
    110310111 (Sp1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    110310111 (Sp1)
Mitochondrial biogenesis [BR:mcal03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    110310111 (Sp1)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4
Other DBs
NCBI-GeneID: 110310111
NCBI-ProteinID: XP_021038462
Ensembl: MGP_CAROLIEiJ_G0020350
LinkDB
Position
15
AA seq 719 aa
MSDQDHSMDEVTAVVKIEKDVGGNNAGSGNGGGAAFSQTRSSSTGSSSSSGGGGGQESQP
SPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTAAQLSQGANGWQIISSSSGATP
TSKEQSGNSTNGSESSKNRTVSGGQYVVAATPNLQNQQVLTGLPGVMPNIQYQVIPQFQT
VDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIIPNRGSGGNIIAAMPNLLQQAVPLQGL
ANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAGTISSSGSQESSSQPVTS
GTAISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTSSGSSGTSSQGQTPQRVGG
LQGSDSLNIQQNQTSGGSLQGSQQKEGEQSQQTQQQQILIQPQLVQGGQALQALQAAPLS
GQTFTTQAISQETLQNLQLQAVQNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQT
ITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSG
IQVHQLPGLPLAIANTPGDHGTQLGLHGSGGDGIHDETAGGEGENSSDLQPQAGRRTRRE
ACTCPYCKDSEGRVAYKREKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTL
PLDSGAGSEGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVTELQSINISGNGF
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgagcgaccaagatcactccatggatgaagtgacagctgtggtgaagattgaaaaagat
gttggtggcaataatgcgggtagcggcaatggtggcggtgccgccttttctcagactcga
agcagcagcacaggcagtagcagcagcagtggtggcggaggagggcaggaatcccagcca
tctcctttggctctgctggcagcaacctgcagcagaattgagtcacccaatgagaacagc
aacaactcccagggtccgagtcagtcagggggcacaggtgaacttgacctcacagccgca
caactttcacagggtgccaatggctggcagatcatctcttcctcctctggggctacccct
acctcaaaggaacagagtggcaacagtaccaatggcagcgagtcttccaagaaccgcaca
gtctctggtgggcagtatgttgtggctgctacccccaacttacagaaccagcaagttctg
acaggtctccctggagtaatgcctaatattcagtatcaagtaatcccacagttccagact
gttgatgggcagcagttgcagtttgctgccactggggcccaagtgcagcaggatggttct
ggtcaaatacagatcataccaggtgcaaaccaacagatcatcccaaatagaggaagcggg
ggcaacattattgctgctatgccaaatctactccagcaggctgtcccccttcaaggcctt
gctaataatgtgctctcaggacagactcagtatgtgaccaatgtaccagtggccctaaat
gggaacatcaccttgctacctgtcaacagcgtttctgcagctaccctgactcccagctct
caggcaggcacgatcagcagctctggatcccaggagagcagctcacagcctgtcacctca
gggactgccatcagttctgccagcttggtgtcatcacaagctagttccagctcctttttt
accaatgccaatagttattcaacaactactaccaccagcaacatgggaattatgaacttt
accagcagtggctcatcagggactagttctcaaggccagacgccccagagggttggtggg
ctacaagggtctgattctctgaacatccagcagaaccagacatcaggaggctcgctgcaa
ggaagtcagcagaaagagggagagcaaagtcagcagacacagcaacaacaaatccttatt
cagcctcagctagttcaaggaggacaagctcttcaggcccttcaagcagcaccattgtcc
ggacagaccttcacaactcaagctatttcccaggaaacccttcagaacctccagcttcag
gctgttcagaactctggtcccatcatcattcggacaccaaccgtggggcccaatggacag
gtcagttggcagacccttcagctgcagaatcttcaagttcagaatccacaagcccagaca
atcaccttggcccctatgcagggtgtttccttggggcagactagcagcagtaataccacc
ctaacacccattgcctcagctgcctccattcctgctggcacagtcactgtgaatgctgct
caactctcctccatgccaggcctccagaccattaacctcagtgcattgggtacttcaggg
atccaggtgcaccagcttccaggcctgcctttggctatagcaaacaccccaggtgatcat
ggaactcaacttggtcttcatggatctggtggtgatgggatacatgatgagacagcaggt
ggagaaggagagaatagctctgacctccaaccccaagctggtcgcaggactcgtcgggaa
gcatgtacatgcccctattgcaaagacagtgagggaagagtggcatataaaagagagaag
aaatttgcctgccctgagtgccctaagcgtttcatgaggagtgatcacctgtcaaagcat
atcaagacccaccagaacaagaagggaggcccaggtgtagccctgagtgtgggcacattg
cccctggacagtggggcaggttcagaaggcactgccactccttcagcccttattaccacc
aatatggtagccatggaggccatctgtccagagggtattgcccgtcttgccaacagtggc
atcaatgtcatgcaggtgacagagctgcagtccattaatatcagtggcaatggtttctaa

DBGET integrated database retrieval system