KEGG   Mus caroli (Ryukyu mouse): 110310223
Entry
110310223         CDS       T05910                                 

Gene name
Scrib
Definition
(RefSeq) protein scribble homolog isoform X1
  KO
K16175  protein scribble
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04390  Hippo signaling pathway
mcal04530  Tight junction
mcal05165  Human papillomavirus infection
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110310223 (Scrib)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110310223 (Scrib)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110310223 (Scrib)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110310223 (Scrib)
SSDB
Motif
Pfam: PDZ PDZ_6 LRR_8 LRR_4 PDZ_2 LRR_9 AbLIM_anchor MscS_porin
Other DBs
NCBI-GeneID: 110310223
NCBI-ProteinID: XP_021038638
Ensembl: MGP_CAROLIEiJ_G0019909
UniProt: A0A6P5QVS4
LinkDB
Position
15
AA seq 1665 aa
MLKCIPLWRCNRHVESVDKRHCSLQVVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLN
LRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRL
PDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLD
LGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCLDVSENRLEELPVELG
GLALLTDLLLSQNLLQRLPEGIGQLKQLSILKVDQNRLCEVTEAIGDCENLSELILTENL
LTALPHSLGKLTKLTNLNVDRNHLEVLPPEIGGCVALSVLSLRDNRLAVLPPELAHTAEL
HVLDVAGNRLRSLPFALTHLNLKALWLAENQAQPMLRFQTEDDAQTGEKVLTCYLLPQQP
LPSLEDAGQQSSPSESCSDAPLSRVSVIQFEDTLGGEEDAEEAAAEKRGLQRRATPHPSE
LKVMKRGIEERRNEAFVCKPDLSPPSPSEEEKRLSAESALSGGSVPSASTASEGEPEILP
AEVQGLGQHEAMPAQEEYTEDDYNEPTVHFAEDTLIPREDGESEEGQPEAAWPLPSGRQR
LIRKDTPHYKKHFKISKLPQPEAVVALLQGVQTDREGPTAGWHNGPHTPWAPRAHEEEEE
EEEENRDEEEGEATTEEDDKEEAVASAPSVKGVSFDQANNLLIEPARIEEEELTLTIVRQ
TGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQDAEHH
EAVEALRGAGAAVQMRVWRERMVEPENAVTITPLRPEDDYSPREWRGGGLRLPLLQPETP
VPLRQRHAACLVRSEKGLGFSIAGGKGSTPYRAGDGGIFISRIAEGGAAHRAGTLQVGDR
VLSINGVDMTEARHDHAVSLLTAASPTISLLLERETGGTYPPSPPPHSSPTPAATVAATV
STAVPGEPLLPRLSPSLLATALEGPYPVEEICLPRAGGPLGLSIVGGSDHSSHPFGVQDP
GVFISKVLPRGLAARCGLRVGDRILAVNGQDVREATHQEAVSALLRPCLELCLLVRRDPP
PPGMRELCIQKAPGEKLGISIRGGAKGHAGNPCDPTDEGIFISKVSPTGAAGRDGRLRVG
LRLLEVNQQSLLGLTHAEAVQLLRSVGDTLTVLVCDGFDTSTTTALEVSPGVIANPFAAG
LGHRNSLESISSIDRELSPEGPGKERELASQALPWDPESAETTGRNLEPLKLDYRALAAL
PSAGSLQRGPSVTTGGKMTEAPCSPGSQQTKPGVIQPLAQAWPRNSPAPRGRGGPCSPPS
PDELPANVKQAYRAFAAVPTVHPPENSATQPPTPGPAASPEQLSFRERQKYFELEVRVPQ
AEGPPKRVSLVGADDLRKMQEEEARKLQQKRAQMLREEAVTSGPDMGLASGRESPDDQQE
AEQPWAVPSHAGGPSPSSPPPLGGNAPVRTAKAERRHQERLRMQSPELPAPERALSPAER
RALEAEKRALWRAARMKSLEQDALRAQMVLSKSQEGRGKRGPLERLAEAPSPAPTPSPTP
LEDFGLQTSASPGRLPLSGKKFDYRAFAALPSSRPVYDIQSPDFVEELRTLEASPSPGSQ
EEDGEVALVLLGRPSPGAVGPEDMTLCSSRRSVRPGRRGLGPVPS
NT seq 4998 nt   +upstreamnt  +downstreamnt
atgctgaagtgcatcccgctctggcgttgcaaccggcacgtggagtcggtggataagcgg
cactgctcgctgcaggttgtgccagaggagatttaccgctacagtcgtagcctggaggag
ctgctcctcgacgccaaccagctgcgcgagctacccaagcccttcttccgactgttgaac
ttgcgaaagttgggcctcagtgacaacgagatccagcggctgcctcctgaagtggccaac
ttcatgcagctggtggagctagacgtgtcccggaatgatattcctgagatacctgagagc
ataaagttctgtaaggctctggagattgcagacttcagtgggaaccccctgtccaggctt
ccggatggcttcacacagctacgcagcctggctcacctggccctgaatgatgtgtccctg
caggcactgcctggagatgtgggcaacctggccaatctggtgaccctggaactccgggag
aacctgcttaaatctctccctgcgtccctgtctttcctggtgaagctggaacagctggat
ctaggaggcaacgacctggaagtgctgcctgacaccctgggggctctgcctaaccttcgg
gagctgtggctagaccgaaaccaactgtcagcgctgcccccggagctaggcaatctgcgg
cggctggtgtgcctggatgtgtcagagaacaggctggaggagctgcctgtggaattgggt
gggctggcactgctcacggatctgctgctttcccagaacctgcttcagcggctgccagag
ggcatcggtcagctgaagcagctgtctatcctgaaggtggaccagaaccggctgtgtgag
gtcactgaggccataggggactgtgagaacctctcggagctgatcctcacggagaacctg
ttaacggccttaccccactcgctgggcaagctgaccaagctgactaacctcaatgtggac
cggaaccatcttgaggtgctgcctcctgaaatcggaggctgtgtggcccttagtgtcctc
tctttgagagacaatcgcctggctgtcctccctcctgagcttgcccatacggctgagctg
cacgtgcttgacgtggctgggaaccggctgcggagtctgccgtttgcgctcacccacctc
aacctcaaggcactgtggctggctgagaaccaggcacagcccatgctccgcttccagact
gaggatgacgcccagacgggtgaaaaggtgctcacctgctacctgctgccccagcagccc
ctgccaagtctcgaagacgctggacagcagagcagtccctcagagagctgtagcgatgcc
cctctgagccgtgtcagtgtcatccagttcgaggacaccctcggaggtgaagaggatgct
gaggaagctgcggccgagaagcggggcctacagcgtagggccacacctcatcccagtgag
ctcaaggtgatgaagaggggcattgaagagcgccggaacgaggccttcgtctgcaagcct
gacctcagcccaccctcgccttcagaggaggagaagaggctgagtgcagagtctgccttg
agtggaggctctgtcccgtcagcaagcacagcctcggaaggtgagcctgagatcctgccg
gctgaggtacaagggttaggccagcatgaggccatgcctgcacaggaggagtacacagaa
gacgactataacgagcccacagtgcactttgcagaggacacactgattcctagggaagac
ggtgaaagtgaagaggggcagcctgaggctgcctggccgctgcctagtggccggcagagg
ctcatccgcaaagacacaccccactacaagaagcacttcaagatctccaagctcccacag
cctgaagctgttgtggccctgctgcaaggggtgcagaccgacagggagggccccactgca
ggttggcacaatggcccacacacaccttgggctcctcgagcccatgaggaggaagaggag
gaggaggaggagaacagggatgaggaggaaggcgaggccaccacggaagaagatgacaaa
gaagaggctgtggcttctgctccctctgtcaagggggtgtcgtttgaccaggccaataac
ctgctgatagagcctgctcgcattgaggaggaagagttaacactcacgatcgtgcggcag
acggggggcctgggcatcagtatcgcagggggaaaaggctctaccccctacaaaggagat
gacgagggcattttcatctctcgagtgtctgaagagggccctgcagcccgtgctggagtc
cgagttggtgacaaacttcttgaggtgaatggtgtagccttgcaggacgcagagcaccat
gaggccgtggaagcacttcggggggcaggtgctgctgtgcagatgcgagtgtggagggaa
agaatggtggagccggagaacgcagtcactattacccccttacgtcctgaagatgactat
agtccccgagagtggcggggaggtggcctgcgccttcccctgctccagcctgagactcct
gtacccctccgtcagcgccatgctgcctgtctcgtgcgcagtgaaaaggggctgggcttc
agcattgctggtggaaagggctccacaccttaccgggctggtgatgggggcatctttata
tcccgcattgcagagggaggggctgctcaccgggcaggcactctacaggttggcgaccgt
gtcctctcgatcaatggagtggacatgactgaggcacggcacgaccatgctgtctccctg
ctgactgctgcttcccctaccatctccctgcttctggagagggagactggagggacttac
ccacctagccctcccccccattcctccccaacccctgctgctactgttgctgctaccgtg
agcactgccgtccccggggaacctctgctacctaggctgtcccctagcctcttggccact
gccttggaaggaccataccctgtggaggaaatctgcctgcccagggctggtggcccattg
gggcttagcattgtaggaggttctgaccactccagccacccgtttggtgtccaagatccc
ggtgtattcatctccaaggtgcttcctcggggcctggctgctcgctgtggccttcgggtt
ggggaccgcatcctagcagtgaatgggcaggatgttcgggaggccacacatcaagaggca
gtcagtgccctgctcaggccctgcctggagctgtgtctgcttgtgcggagggacccacca
cccccgggcatgcgggaactctgcatccagaaggcccctggggagaagctgggtatcagc
atccgtggaggtgccaagggtcacgcggggaacccctgtgaccctacagatgagggcatc
tttatctccaaggtgagccccacaggagctgccgggcgtgatgggcggctgcgtgtgggg
ctgcggctgctagaagtgaaccaacagagcctgctgggccttacccatgcggaggcagtg
cagctgctgcgcagcgtgggcgacacccttaccgtgcttgtctgtgatggttttgacacc
agcaccaccacagccctggaggtgtccccaggtgtcattgccaacccatttgcagcaggc
cttggccacaggaacagtctggaaagcatttcgtccattgaccgggaactgagtcctgaa
ggcccaggcaaggagagagagttggccagtcaagccctaccctgggatcctgagtctgca
gagaccacgggtcggaatctagagcccctgaagctggactatcgtgccctggccgccctg
cccagtgctgggagtttgcagagaggaccatctgtgaccactggagggaagatgactgag
gctccctgttcccctggcagtcagcaaacaaaaccgggggtgatccagccattggctcag
gcctggccaaggaactccccggcccccaggggcagaggtggtccctgttctccaccctcc
cctgatgaactgccagccaatgtgaagcaggcgtatagggccttcgcagctgtgcccact
gtgcatcctcctgagaacagtgctacccagcctccaacacctggtcccgcagcctcccca
gagcagctgtccttccgtgaacgacaaaagtacttcgagctggaggtacgggtgcctcaa
gcagagggtcccccaaagcgcgtgtccctggtgggtgctgatgacttgcggaagatgcag
gaggaggaagctcgcaagctgcagcagaagagggcgcagatgcttcgggaagaagcagta
acctcagggcctgacatggggctcgcctcaggcagggagtccccagatgatcagcaggag
gctgagcagccctgggctgtgccaagccatgcagggggccctagcccatcatcaccccca
cccctgggaggcaacgcccctgtgaggacagccaaagctgagcgacgccatcaggaacgg
ttacgcatgcagagccccgagcttcctgccccggaacgggccctgtctcctgcagagcga
cgggctctagaggcagagaagcgagctctgtggagggcagccagaatgaaatctctggag
caggatgctctccgtgcacagatggtccttagcaagtcccaggaaggccgtggcaagaga
ggacccttggaacggctggctgaggccccttcacctgcacccaccccatcacccacacca
ttggaagacttcggcctccagaccagtgcctcccctggacgcttgcctttgtctggaaag
aagtttgactacagggccttcgcagccctgccctcttccagacctgtgtatgacatccag
tcaccagatttcgtggaggagctgaggactttggaagcatctcccagtcctggctcccag
gaagaagatggagaagtggccttggtgctccttggcaggccctcacctggcgctgtgggc
cctgaagacatgacgctgtgcagcagccgtcggtctgtgcggccaggacgccggggcctg
ggccctgtgccctcctag

DBGET integrated database retrieval system