KEGG   Mus caroli (Ryukyu mouse): 110310271
Entry
110310271         CDS       T05910                                 

Gene name
Ptk2
Definition
(RefSeq) focal adhesion kinase 1 isoform X1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04012  ErbB signaling pathway
mcal04062  Chemokine signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04360  Axon guidance
mcal04370  VEGF signaling pathway
mcal04510  Focal adhesion
mcal04670  Leukocyte transendothelial migration
mcal04810  Regulation of actin cytoskeleton
mcal04935  Growth hormone synthesis, secretion and action
mcal05100  Bacterial invasion of epithelial cells
mcal05135  Yersinia infection
mcal05146  Amoebiasis
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05205  Proteoglycans in cancer
mcal05222  Small cell lung cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110310271 (Ptk2)
   04370 VEGF signaling pathway
    110310271 (Ptk2)
   04151 PI3K-Akt signaling pathway
    110310271 (Ptk2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110310271 (Ptk2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110310271 (Ptk2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110310271 (Ptk2)
   04062 Chemokine signaling pathway
    110310271 (Ptk2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    110310271 (Ptk2)
  09158 Development and regeneration
   04360 Axon guidance
    110310271 (Ptk2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110310271 (Ptk2)
   05202 Transcriptional misregulation in cancer
    110310271 (Ptk2)
   05205 Proteoglycans in cancer
    110310271 (Ptk2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110310271 (Ptk2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110310271 (Ptk2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110310271 (Ptk2)
   05100 Bacterial invasion of epithelial cells
    110310271 (Ptk2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110310271 (Ptk2)
   05163 Human cytomegalovirus infection
    110310271 (Ptk2)
   05165 Human papillomavirus infection
    110310271 (Ptk2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110310271 (Ptk2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110310271 (Ptk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110310271 (Ptk2)
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110310271 (Ptk2)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     110310271 (Ptk2)
Protein kinases [BR:mcal01001]
 Non-receptor tyrosine kinases
  FAK family
   110310271 (Ptk2)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110310271 (Ptk2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 110310271
NCBI-ProteinID: XP_021038716
Ensembl: MGP_CAROLIEiJ_G0019862
LinkDB
Position
15
AA seq 1155 aa
MLLERAGQEALRPTGAVCMEKSGCSPFPVCWAKEYDRYLASSKRMAAAYLDPNLNHTPSS
STKTHLGTGMERSPGAMERVLKVFHYFESSSEPTTWASIIRHGDATDVRGIIQKIVDSHK
VKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQ
FTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEV
LEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKE
CFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGML
QLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKL
ANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSKSYGIDEARDYEIQRERIELGRCIG
EGQFGDVHQGVYLSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGV
ITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAA
RNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFG
VCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRF
TELKAQLSTILEEEKVQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGF
YPSPQHMVQTNHYQVSGYPGSHGIPAMAGSIYPGQASLLDQTELWNHRPQEMSMWQPSVE
DSAALDLRGMGQVLPPHLMEERLIRQQQEMEEDQRWLEKEERFLALHRPIQSQQILMSKP
DAVRRKRQTNEAVHREGEVKCFEKNLKRRFKEQKPDVRLSRGSIDREDGSFQGPTGNQHI
YQPVGKPDPAAPPKKPPRPGAPGHLSNLSSISSPADSYNEGVKPWRLQPQEISPPPTANL
DRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPVLPA
STHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDV
IDQARLKMLGQTRPH
NT seq 3468 nt   +upstreamnt  +downstreamnt
atgttgttggaacgggcaggccaagaggccctgagacctacaggtgccgtctgtatggag
aaaagcggctgtagtccatttccagtgtgttgggctaaagaatatgacagatacctagca
tctagcaaaagaatggcagctgcttatcttgacccaaacttgaaccacacaccaagttcg
agtactaagactcacctgggtactggcatggaacggtcccctggtgcaatggaacgagta
ttaaaggtctttcattattttgaaagcagtagtgagccaaccacctgggccagtattatc
aggcatggagatgctactgatgtcaggggcatcattcagaagatagtggacagtcacaaa
gtaaagcacgtggcctgctatggatttcgcctcagtcacctgcgatcggaggaggtgcac
tggctgcacgtggacatgggtgtctccagtgtaagggagaaatatgaactcgcccaccca
ccagaggagtggaaatatgagttgagaattcgttacttgccaaaaggatttctaaaccag
tttactgaagataagccaacattgaatttcttctatcaacaggtgaagagtgactacatg
ctagaaatagctgatcaagtagaccaagaaatagctttgaagttgggttgtttggaaatt
aggcgatcctattgggagatgaggggtaatgccctagagaagaagtccaactatgaagtg
ttagaaaaagatgttggtttaaagcgattttttcctaagagtttactggattctgtcaag
gccaaaacactaagaaagctgatccagcaaacattcaggcagtttgccaaccttaataga
gaagaaagcatcctgaaattctttgagattctttctcctgtgtacagatttgacaaagag
tgcttcaagtgtgcccttgggtcaagttggatcatttctgtggaattggcaatcggccca
gaagaagggatcagttacctgacagacaaaggctgcaatcccacacacctagcagacttt
aaccaagtgcagaccatccagtactcaaacagtgaagacaaagacaggaaagggatgcta
caactcaaaatcgctggcgctcctgagcctctgacagtgacggcaccatccctaaccatt
gcagagaacatggccgacctgatcgatggatactgccggctggtgaatggagccacacaa
tctttcatcatcagaccccagaaagaaggtgaacgggcgttgccatcaataccaaagttg
gccaacagtgaaaagcaaggcatgcggacacatgcagtctctgtgtcagagacagatgac
tatgctgagatcatcgatgaggaagacacatacaccatgccctcgaaaagctatggaata
gatgaagccagggattatgagattcagagagaaagaatagaactcggacgctgtattgga
gaaggtcagtttggagatgtacatcaaggcgtgtacctgagcccagagaatccagctttg
gctgttgcaatcaaaacatgtaaaaactgtacttcggacagcgtgagagagaagttcctt
caagaagccttaacaatgcgtcagtttgaccatcctcacatcgtgaagctgattggagtc
attacagagaaccccgtctggataatcatggagttgtgcacacttggagagctgaggtca
tttttgcaagtaagaaaatacagcttggacctggcatctttgatcttatatgcctatcag
cttagtacagcactcgcgtatctggagagcaaaagatttgttcacagggacattgctgct
cggaatgttctggtgtcttcaaatgattgtgtaaaattaggagactttggattatctcga
tatatggaagacagtacttactataaagcttccaaaggaaaattacctattaaatggatg
gctccagagtcaatcaattttcgacgttttacctcagctagtgacgtgtggatgtttggt
gtgtgtatgtgggagatactgatgcatggcgtgaagccttttcaaggagtgaagaacaat
gatgtgatcggtcgaattgaaaatggggaaagattaccaatgcctccaaattgtcctcct
accctctacagccttatgacgaaatgttgggcctatgaccccagcaggcggcccaggttt
actgaactaaaagctcagctcagcacaatcctggaggaagagaaggtgcagcaagaagaa
cggatgaggatggaatccagaagacaggctaccgtgtcctgggactctggagggtctgat
gaagcaccacccaagcccagcagacctggttatcctagcccgagatccagtgaaggattt
tatcccagcccacagcacatggtccagaccaatcactaccaggtctctggctacccgggt
tcccatggaatcccagccatggctggcagcatttacccaggtcaggcatctcttctggac
cagacagaattgtggaatcacagacctcaggagatgtccatgtggcagcccagtgtggag
gattccgcagctttggaccttcgagggatgggacaggtgcttccccctcacctgatggaa
gagcggctaatccgacagcagcaggaaatggaagaagaccagcgctggctggagaaggaa
gagcgattcctggctcttcacaggcccatccagtctcagcaaatactgatgagtaagcca
gatgcagtgaggagaaagagacaaactaatgaagcagtacacagagaaggagaagttaaa
tgctttgaaaagaatctgaagaggagattcaaagaacagaaacctgatgtgaggctctct
cgaggcagcatcgacagggaggacgggagttttcagggtccgactggaaaccaacacatc
tatcagcctgtggggaaaccagatcctgcagctccaccaaagaaacctcctcgtcctgga
gcacctggccacctaagcaacctgtccagcatcagcagccctgcagacagctacaatgag
ggtgtcaagccgtggaggcttcaaccccaggaaatcagcccccctcccactgccaacctt
gaccggtccaatgacaaggtatatgaaaatgtgacaggcctggtgaaggctgtcatcgag
atgtccagcaagatccagccagctcctccagaagagtacgtccctatggtgaaggaagtt
ggcctggccctgcggaccttactggccactgtggatgagaccattcctgttcttccagcc
agcactcatcgagagatcgagatggcacagaagctgctgaactccgacttaggcgagctc
atcagcaagatgaagctggcacagcagtatgtcatgaccagcctgcagcaggagtacaag
aagcagatgctgacagctgctcacgccctggctgtggatgccaagaatctacttgatgtt
attgatcaagcaagactgaaaatgctagggcagacacggccacactga

DBGET integrated database retrieval system